StarFunc result for job id P19438

User Input

>input (455 residues)
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19438	1.000	1.000	9.292E-82	455	1.000	1.000	P19438.pdb.gz	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
2	AFDB:P22934	0.478	0.472	2.721E-56	461	0.651	0.642	P22934.pdb.gz	TNR1A_RAT Tumor necrosis factor receptor superfamily member 1A OS=Rattus norvegicus OX=10116 GN=Tnfrsf1a PE=2 SV=2
3	AFDB:O19131	0.339	0.327	1.007E-52	471	0.651	0.628	O19131.pdb.gz	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
4	AFDB:P25118	0.371	0.372	1.930E-52	454	0.640	0.641	P25118.pdb.gz	TNR1A_MOUSE Tumor necrosis factor receptor superfamily member 1A OS=Mus musculus OX=10090 GN=Tnfrsf1a PE=1 SV=1
5	AFDB:F1QQS0	0.292	0.334	5.077E-23	389	0.220	0.257	F1QQS0.pdb.gz
6	AFDB:Q9DFV0	0.284	0.293	2.381E-19	438	0.196	0.203	Q9DFV0.pdb.gz
7	AFDB:F1QD95	0.273	0.294	7.319E-19	418	0.193	0.211	F1QD95.pdb.gz	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
8	AFDB:Q6E5U7	0.243	0.347	3.651E-14	312	0.165	0.240	Q6E5U7.pdb.gz	Q6E5U7_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=fas PE=2 SV=1
9	AFDB:Q92956	0.244	0.372	4.359E-14	283	0.123	0.198	Q92956.pdb.gz	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
10	AFDB:Q71F55	0.260	0.404	3.661E-13	276	0.132	0.217	Q71F55.pdb.gz	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
11	PDB:2hm2Q	0.133	0.507	6.340E-2	89	0.046	0.236	2hm2Q.pdb.gz
12	PDB:4phcA	0.071	0.072	8.053E-1	444	0.022	0.023	4phcA.pdb.gz	Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
13	PDB:7dtvA	0.095	0.063	9.616E-1	779	0.042	0.024	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
14	PDB:8a7dQ	0.101	0.145	1.020	273	0.051	0.084	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	PDB:2jmhA	0.072	0.165	1.292	117	0.040	0.154	2jmhA.pdb.gz
16	PDB:4k34A	0.070	0.080	1.292	381	0.026	0.031	4k34A.pdb.gz
17	PDB:7pzcA	0.123	0.062	1.543	1010	0.024	0.011	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
18	PDB:3f29B	0.073	0.066	2.200	520	0.024	0.021	3f29B.pdb.gz	Binding of sulfite by the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase
19	PDB:7pntL	0.072	0.137	2.627	176	0.022	0.057	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
20	PDB:6ki0A	0.144	0.143	2.787	459	0.031	0.031	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O19131	0.0	525	471	0.664	0.641	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
2	P19438	0.0	932	455	1.000	1.000	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
3	P22934	0.0	569	461	0.646	0.638	TNR1A_RAT Tumor necrosis factor receptor superfamily member 1A OS=Rattus norvegicus OX=10116 GN=Tnfrsf1a PE=2 SV=2
4	P25118	0.0	525	454	0.642	0.643	TNR1A_MOUSE Tumor necrosis factor receptor superfamily member 1A OS=Mus musculus OX=10090 GN=Tnfrsf1a PE=1 SV=1
5	Q93038	4.08e-24	105	417	0.257	0.281	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
6	Q6NUU6	1.96e-13	73.9	389	0.136	0.159	Q6NUU6_DANRE Tumor necrosis factor receptor superfamily member 1A precursor OS=Danio rerio OX=7955 GN=zgc:85914 PE=2 SV=1
7	P36941	8.71e-12	68.9	435	0.147	0.154	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
8	Q9ER63	2.74e-10	61.6	176	0.097	0.250	TNR23_MOUSE Tumor necrosis factor receptor superfamily member 23 OS=Mus musculus OX=10090 GN=Tnfrsf23 PE=2 SV=2
9	Q9ER62	2.76e-10	62.0	198	0.090	0.207	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3
10	F1QG24	5.86e-09	59.3	293	0.097	0.150	F1QG24_DANRE Tumor necrosis factor receptor superfamily member 6 OS=Danio rerio OX=7955 GN=fas PE=4 SV=1
11	P25119	3.29e-08	58.2	474	0.108	0.103	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
12	Q0PKX6	6.42e-08	57.0	436	0.075	0.078	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
13	Q80WY6	1.02e-07	56.6	474	0.114	0.110	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
14	F5H6F8	1.38e-07	54.3	217	0.138	0.290	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
15	P08138	3.13e-07	54.7	427	0.119	0.126	TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1
16	Q71F55	5.15e-07	53.1	276	0.121	0.199	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
17	P50284	7.06e-07	53.5	415	0.103	0.113	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
18	Q80WM9	7.99e-07	52.8	275	0.121	0.200	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
19	F1RAS9	1.09e-06	53.1	425	0.057	0.061	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
20	F1QD95	1.87e-06	52.4	418	0.097	0.105	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	2.2e-14	64.7	Death domain
2	PF00020 TNFR_c6	8.9e-19	79.0	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000162749

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
2	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000301838	0.999	FAS-associated death domain protein
4	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
5	9606.ENSP00000351273	0.999	Caspase-8
6	9606.ENSP00000398698	0.999	Tumor necrosis factor
7	9606.ENSP00000403495	0.999	Lymphotoxin-alpha
8	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
9	9606.ENSP00000481570	0.999	Tumor necrosis factor alpha-induced protein 3
10	9606.ENSP00000365435	0.998	Tumor necrosis factor receptor superfamily member 1B
11	9606.ENSP00000392025	0.998	Ubiquitin carboxyl-terminal hydrolase CYLD
12	9606.ENSP00000483825	0.998	NF-kappa-B essential modulator
13	9606.ENSP00000287322	0.997	BAG family molecular chaperone regulator 4
14	9606.ENSP00000359424	0.997	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000430684	0.997	Inhibitor of nuclear factor kappa-B kinase subunit beta
16	9606.ENSP00000362994	0.996	TNF receptor-associated factor 1
17	9606.ENSP00000263464	0.995	Baculoviral IAP repeat-containing protein 3
18	9606.ENSP00000411012	0.995	Protein FAN
19	9606.ENSP00000053867	0.993	Granulins
20	9606.ENSP00000358335	0.993	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0005035	0.999	death receptor activity
GO:0005031	0.959	tumor necrosis factor receptor activity
GO:0043120	0.651	tumor necrosis factor binding
GO:0019899	0.578	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.995	signal transduction
GO:0048583	0.992	regulation of response to stimulus
GO:0023051	0.990	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0034097	0.977	response to cytokine
GO:0070887	0.972	cellular response to chemical stimulus
GO:0048519	0.968	negative regulation of biological process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0071310	0.960	cellular response to organic substance
GO:0010468	0.958	regulation of gene expression
GO:0009966	0.956	regulation of signal transduction
GO:0080090	0.955	regulation of primary metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0048522	0.953	positive regulation of cellular process
GO:0051239	0.950	regulation of multicellular organismal process
GO:0048584	0.946	positive regulation of response to stimulus
GO:0009605	0.927	response to external stimulus
GO:0007166	0.922	cell surface receptor signaling pathway
GO:0012501	0.918	programmed cell death
GO:0006915	0.913	apoptotic process
GO:0010647	0.910	positive regulation of cell communication
GO:0023056	0.909	positive regulation of signaling
GO:0051173	0.902	positive regulation of nitrogen compound metabolic process
GO:0031399	0.901	regulation of protein modification process
GO:0051247	0.888	positive regulation of protein metabolic process
GO:0031325	0.877	positive regulation of cellular metabolic process
GO:0080134	0.869	regulation of response to stress
GO:1902531	0.868	regulation of intracellular signal transduction
GO:0009967	0.868	positive regulation of signal transduction
GO:1902533	0.859	positive regulation of intracellular signal transduction
GO:0006355	0.846	regulation of DNA-templated transcription
GO:0097190	0.832	apoptotic signaling pathway
GO:0001932	0.819	regulation of protein phosphorylation
GO:0071345	0.794	cellular response to cytokine stimulus
GO:0031401	0.783	positive regulation of protein modification process
GO:0045937	0.755	positive regulation of phosphate metabolic process
GO:0032101	0.745	regulation of response to external stimulus
GO:0097191	0.737	extrinsic apoptotic signaling pathway
GO:0042327	0.736	positive regulation of phosphorylation
GO:0071260	0.726	cellular response to mechanical stimulus
GO:0031347	0.713	regulation of defense response
GO:0050793	0.699	regulation of developmental process
GO:0019221	0.618	cytokine-mediated signaling pathway
GO:0048585	0.614	negative regulation of response to stimulus
GO:0001934	0.564	positive regulation of protein phosphorylation
GO:0043122	0.536	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006950	0.507	response to stress
GO:0048523	0.491	negative regulation of cellular process
GO:0010941	0.445	regulation of cell death
GO:0071704	0.439	organic substance metabolic process
GO:0043067	0.426	regulation of programmed cell death
GO:0034612	0.413	response to tumor necrosis factor
GO:0042981	0.410	regulation of apoptotic process
GO:0043123	0.386	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0008625	0.381	extrinsic apoptotic signaling pathway via death domain receptors
GO:0045935	0.380	positive regulation of nucleobase-containing compound metabolic process
GO:0071356	0.378	cellular response to tumor necrosis factor
GO:0009891	0.373	positive regulation of biosynthetic process
GO:0031328	0.357	positive regulation of cellular biosynthetic process
GO:0065009	0.354	regulation of molecular function
GO:0010557	0.353	positive regulation of macromolecule biosynthetic process
GO:0044093	0.329	positive regulation of molecular function
GO:0033209	0.322	tumor necrosis factor-mediated signaling pathway
GO:0045893	0.322	positive regulation of DNA-templated transcription
GO:0032502	0.321	developmental process
GO:0045595	0.315	regulation of cell differentiation
GO:0048856	0.312	anatomical structure development
GO:0006807	0.304	nitrogen compound metabolic process
GO:0044419	0.302	biological process involved in interspecies interaction between organisms
GO:0009607	0.302	response to biotic stimulus
GO:0050727	0.302	regulation of inflammatory response
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.997	protein-containing complex
GO:0012505	0.995	endomembrane system
GO:0005576	0.992	extracellular region
GO:0005615	0.979	extracellular space
GO:0098857	0.960	membrane microdomain
GO:0045121	0.954	membrane raft
GO:0031090	0.937	organelle membrane
GO:0005829	0.925	cytosol
GO:0005794	0.723	Golgi apparatus
GO:0098588	0.697	bounding membrane of organelle
GO:0005634	0.661	nucleus
GO:0043235	0.637	receptor complex
GO:0070013	0.531	intracellular organelle lumen
GO:0031981	0.497	nuclear lumen
GO:0009986	0.435	cell surface
GO:0000139	0.396	Golgi membrane
GO:0005654	0.390	nucleoplasm
GO:0002947	0.384	tumor necrosis factor receptor superfamily complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]