StarFunc result for job id P19447

User Input

>input (782 residues)
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC
HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR
CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS
WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK
FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY
SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF
RK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y6W8	0.917	0.890	0.000	807	1.000	0.969	A0A2R8Y6W8.pdb.gz	A0A2R8Y6W8_HUMAN General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
2	AFDB:Q02870	0.858	0.842	0.000	798	0.683	0.669	Q02870.pdb.gz	ERCC3_DROME General transcription and DNA repair factor IIH helicase subunit XPB OS=Drosophila melanogaster OX=7227 GN=hay PE=1 SV=2
3	AFDB:Q5ZKK7	0.948	0.941	0.000	788	0.907	0.900	Q5ZKK7.pdb.gz	ERCC3_CHICK General transcription and DNA repair factor IIH helicase subunit XPB OS=Gallus gallus OX=9031 GN=ERCC3 PE=2 SV=1
4	AFDB:Q38861	0.800	0.816	1.532E-95	767	0.520	0.531	Q38861.pdb.gz	XPB1_ARATH General transcription and DNA repair factor IIH helicase subunit XPB1 OS=Arabidopsis thaliana OX=3702 GN=XPB1 PE=2 SV=3
5	AFDB:O00835	0.798	0.781	8.693E-94	800	0.518	0.506	O00835.pdb.gz	ERCC3_DICDI General transcription and DNA repair factor IIH helicase subunit XPB OS=Dictyostelium discoideum OX=44689 GN=repB PE=2 SV=1
6	AFDB:O13768	0.804	0.783	3.737E-93	804	0.529	0.515	O13768.pdb.gz	ERCC3_SCHPO General transcription and DNA repair factor IIH helicase subunit XPB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr8 PE=1 SV=1
7	AFDB:Q00578	0.790	0.735	2.127E-92	843	0.533	0.495	Q00578.pdb.gz	RAD25_YEAST General transcription and DNA repair factor IIH helicase subunit XPB OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL2 PE=1 SV=1
8	PDB:7lbmW	0.680	0.915	1.145E-89	574	0.731	0.997	7lbmW.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
9	PDB:7ena6	0.719	0.851	3.172E-73	652	0.832	0.998	7ena6.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
10	PDB:7zsa7	0.688	0.861	6.218E-73	616	0.485	0.615	7zsa7.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
11	PDB:7k047	0.662	0.796	1.733E-58	638	0.490	0.600	7k047.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
12	AFDB:Q580W5	0.676	0.568	2.260E-55	938	0.284	0.237	Q580W5.pdb.gz	XPB_TRYB2 TFIIH basal transcription factor complex helicase XPB subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=XPB PE=1 SV=1
13	AFDB:Q381F9	0.649	0.653	4.956E-55	777	0.290	0.292	Q381F9.pdb.gz	XPBR_TRYB2 DNA repair helicase XPB-R OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=XPB-R PE=3 SV=1
14	PDB:7ml37	0.612	0.854	6.902E-51	548	0.440	0.628	7ml37.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
15	AFDB:E9ADR1	0.583	0.416	1.257E-46	1106	0.275	0.194	E9ADR1.pdb.gz	E9ADR1_LEIMA DNA helicase OS=Leishmania major OX=5664 GN=LMJF_29_0590 PE=3 SV=1
16	PDB:6gym7	0.480	0.893	4.789E-41	408	0.325	0.623	6gym7.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
17	PDB:7r7jB	0.323	0.424	3.163E-14	574	0.111	0.152	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
18	PDB:7oo3b	0.380	0.537	5.861E-14	534	0.084	0.124	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
19	PDB:6tdaS	0.365	0.364	4.939E-13	783	0.120	0.120	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
20	PDB:6g0lM	0.350	0.323	1.282E-12	855	0.093	0.085	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y6W8	0.0	1624	807	1.000	0.969	A0A2R8Y6W8_HUMAN General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
2	O00835	0.0	840	800	0.538	0.526	ERCC3_DICDI General transcription and DNA repair factor IIH helicase subunit XPB OS=Dictyostelium discoideum OX=44689 GN=repB PE=2 SV=1
3	O13768	0.0	817	804	0.543	0.529	ERCC3_SCHPO General transcription and DNA repair factor IIH helicase subunit XPB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr8 PE=1 SV=1
4	P19447	0.0	1640	782	1.000	1.000	ERCC3_HUMAN General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
5	P49135	0.0	1525	783	0.959	0.958	ERCC3_MOUSE General transcription and DNA repair factor IIH helicase subunit XPB OS=Mus musculus OX=10090 GN=Ercc3 PE=2 SV=1
6	Q00578	0.0	816	843	0.526	0.488	RAD25_YEAST General transcription and DNA repair factor IIH helicase subunit XPB OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL2 PE=1 SV=1
7	Q02870	0.0	1109	798	0.698	0.684	ERCC3_DROME General transcription and DNA repair factor IIH helicase subunit XPB OS=Drosophila melanogaster OX=7227 GN=hay PE=1 SV=2
8	Q38861	0.0	781	767	0.523	0.533	XPB1_ARATH General transcription and DNA repair factor IIH helicase subunit XPB1 OS=Arabidopsis thaliana OX=3702 GN=XPB1 PE=2 SV=3
9	Q4G005	0.0	1532	782	0.959	0.959	ERCC3_RAT General transcription and DNA repair factor IIH helicase subunit XPB OS=Rattus norvegicus OX=10116 GN=Ercc3 PE=1 SV=1
10	Q5ZKK7	0.0	1420	788	0.893	0.886	ERCC3_CHICK General transcription and DNA repair factor IIH helicase subunit XPB OS=Gallus gallus OX=9031 GN=ERCC3 PE=2 SV=1
11	Q9FUG4	0.0	803	766	0.520	0.531	XPB2_ARATH General transcription and DNA repair factor IIH helicase subunit XPB2 OS=Arabidopsis thaliana OX=3702 GN=XPB2 PE=2 SV=1
12	H7C309	1.26e-124	372	188	0.231	0.963	H7C309_HUMAN ERCC excision repair 3, TFIIH core complex helicase subunit (Fragment) OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
13	Q580W5	2.22e-101	336	938	0.226	0.189	XPB_TRYB2 TFIIH basal transcription factor complex helicase XPB subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=XPB PE=1 SV=1
14	Q381F9	1.31e-94	314	777	0.224	0.225	XPBR_TRYB2 DNA repair helicase XPB-R OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=XPB-R PE=3 SV=1
15	A0A2R8Y762	5.65e-87	276	216	0.170	0.616	A0A2R8Y762_HUMAN ERCC excision repair 3, TFIIH core complex helicase subunit (Fragment) OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1
16	O53873	8.96e-66	230	549	0.174	0.248	XPB_MYCTU DNA helicase XPB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=XPB PE=1 SV=2
17	E9ADR1	7.52e-54	204	1106	0.139	0.099	E9ADR1_LEIMA DNA helicase OS=Leishmania major OX=5664 GN=LMJF_29_0590 PE=3 SV=1
18	P33919	1.09e-06	54.7	586	0.124	0.166	RADD_ECOLI Putative DNA repair helicase RadD OS=Escherichia coli (strain K12) OX=83333 GN=radD PE=1 SV=2
19	P11107	0.007	42.0	450	0.049	0.084	HEL10_BPT5 Probable helicase D10 OS=Escherichia phage T5 OX=2695836 GN=D10 PE=2 SV=1
20	P53115	0.007	42.4	1489	0.086	0.045	INO80_YEAST Chromatin-remodeling ATPase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INO80 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13872 AAA_34	66	13.8	P-loop containing NTP hydrolase pore-1
2	PF00270 DEAD	18	16.5	DEAD/DEAH box helicase
3	PF16203 ERCC3_RAD25_C	1.8e-123	422.2	ERCC3/RAD25/XPB C-terminal helicase
4	PF00271 Helicase_C	9.8e-07	40.5	Helicase conserved C-terminal domain
5	PF13625 Helicase_C_3	2.5e-36	135.9	Helicase conserved C-terminal domain
6	PF04851 ResIII	5e-12	57.7	Type III restriction enzyme, res subunit
7	PF00176 SNF2-rel_dom	21	15.5	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000256897	0.999	Cyclin-H
3	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
4	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
5	9606.ENSP00000265963	0.999	General transcription factor IIH subunit 1
6	9606.ENSP00000283875	0.999	General transcription factor IIE subunit 1
7	9606.ENSP00000328901	0.999	General transcription factor IIH subunit 2
8	9606.ENSP00000348168	0.999	Transcription initiation factor IIE subunit beta
9	9606.ENSP00000359531	0.999	Transcription initiation factor IIB
10	9606.ENSP00000375809	0.999	TFIIH basal transcription factor complex helicase XPD subunit
11	9606.ENSP00000445162	0.999	General transcription factor IIH subunit 3
12	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
13	9606.ENSP00000375942	0.998	TATA-box-binding protein
14	9606.ENSP00000452454	0.997	Transcription initiation factor IIA subunit 1
15	9606.ENSP00000480158	0.997	DNA-directed RNA polymerase II subunit RPB1
16	9606.ENSP00000377969	0.996	General transcription factor IIF subunit 1
17	9606.ENSP00000340823	0.995	General transcription factor IIF subunit 2
18	9606.ENSP00000379372	0.995	Transcription initiation factor IIA subunit 2
19	9606.ENSP00000422907	0.994	General transcription factor IIH subunit 2-like protein
20	9606.ENSP00000403852	0.993	DNA-directed RNA polymerases I, II, and III subunit RPABC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016787	0.998	hydrolase activity
GO:0005515	0.997	protein binding
GO:0003678	0.996	DNA helicase activity
GO:0016887	0.992	ATP hydrolysis activity
GO:0003676	0.991	nucleic acid binding
GO:0003677	0.981	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0050896	0.989	response to stimulus
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0090304	0.984	nucleic acid metabolic process
GO:0009628	0.968	response to abiotic stimulus
GO:0009411	0.957	response to UV
GO:0006351	0.949	DNA-templated transcription
GO:0006950	0.682	response to stress
GO:0006366	0.677	transcription by RNA polymerase II
GO:0065007	0.537	biological regulation
GO:0050789	0.522	regulation of biological process
GO:0050794	0.466	regulation of cellular process
GO:0051716	0.384	cellular response to stimulus
GO:0033554	0.356	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:0090575	0.982	RNA polymerase II transcription regulator complex
GO:0000428	0.936	DNA-directed RNA polymerase complex
GO:0016591	0.931	RNA polymerase II, holoenzyme
GO:0005675	0.756	transcription factor TFIIH holo complex
GO:0000439	0.712	transcription factor TFIIH core complex
GO:0043232	0.583	intracellular non-membrane-bounded organelle
GO:0005669	0.363	transcription factor TFIID complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.998	Hydrolases.
RHEA:13065	0.992	ATP + H2O = ADP + H(+) + phosphate

[back to server]