StarFunc result for job id P19474

User Input

>input (475 residues)
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLL
KNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKH
RDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHA
EFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSA
LELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWL
ILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCR
DSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19474	1.000	1.000	4.181E-90	475	1.000	1.000	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
2	AFDB:Q62191	0.899	0.908	4.727E-71	470	0.682	0.689	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
3	AFDB:Q5NCC9	0.738	0.723	7.879E-50	485	0.406	0.398	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
4	AFDB:Q8BGE7	0.357	0.348	1.161E-47	488	0.457	0.445	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
5	AFDB:A0A024RCP5	0.619	0.574	3.372E-47	518	0.417	0.382	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
6	AFDB:A0A024RCR1	0.400	0.391	4.994E-47	488	0.413	0.402	A0A024RCR1.pdb.gz
7	AFDB:A0A1U9X8R9	0.380	0.352	5.282E-47	513	0.389	0.361	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
8	AFDB:Q9C030	0.360	0.350	7.396E-47	488	0.463	0.451	Q9C030.pdb.gz	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
9	AFDB:Q6AZZ1	0.535	0.525	8.274E-47	485	0.434	0.425	Q6AZZ1.pdb.gz	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
10	AFDB:O00635	0.375	0.383	1.095E-46	465	0.415	0.424	O00635.pdb.gz	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
11	PDB:7y4sA	0.366	0.500	2.158E-22	343	0.185	0.257	7y4sA.pdb.gz
12	PDB:4b3nA	0.321	0.276	6.961E-19	557	0.152	0.129	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.352	0.452	4.877E-11	362	0.173	0.227	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7z36B	0.286	0.302	5.744E-9	446	0.118	0.126	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:7ccbA	0.258	0.683	7.155E-7	164	0.055	0.159	7ccbA.pdb.gz
16	PDB:7nscA	0.260	0.427	3.623E-4	276	0.048	0.083	7nscA.pdb.gz
17	PDB:5t15B	0.206	0.026	5.676E-4	4170	0.046	0.005	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
18	PDB:7m6aA	0.216	0.026	7.947E-4	4306	0.048	0.005	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
19	PDB:6swy1	0.224	0.200	8.406E-4	542	0.057	0.050	6swy1.pdb.gz
20	PDB:7nsba	0.225	0.193	9.404E-4	568	0.061	0.051	7nsba.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19474	0.0	987	475	1.000	1.000	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
2	Q3U7K7	0.0	695	462	0.684	0.703	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
3	Q62191	0.0	693	470	0.682	0.689	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
4	Q9C030	2.08e-135	401	488	0.455	0.443	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
5	Q8BGE7	1.34e-131	391	488	0.455	0.443	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
6	Q6AZZ1	7.35e-126	376	485	0.436	0.427	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
7	Q8IYM9	7.37e-120	362	498	0.427	0.408	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
8	O00635	8.13e-116	350	465	0.408	0.417	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
9	Q587N6	2.31e-114	347	495	0.436	0.418	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
10	Q0PF16	2.37e-114	347	497	0.432	0.412	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
11	Q5NCC9	4.80e-114	346	485	0.413	0.404	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
12	Q9C035	4.10e-113	344	493	0.423	0.408	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
13	Q5D7I0	7.02e-113	343	494	0.429	0.413	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
14	Q5C8U4	6.34e-111	339	515	0.425	0.392	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
15	Q5C8U3	1.22e-110	338	515	0.429	0.396	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
16	A0A024RCP5	2.91e-110	337	518	0.406	0.373	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
17	Q9HCM9	2.91e-110	337	518	0.406	0.373	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
18	Q96F44	2.67e-108	331	468	0.432	0.438	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
19	Q62158	3.42e-108	332	513	0.396	0.366	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
20	Q99PQ2	8.06e-108	330	467	0.440	0.448	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03754 At2g31720-like	4.2e+02	12.5	B3 domain-containing protein At2g31720-like
2	PF18912 DZR_2	8.1e+02	11.3	Double zinc ribbon domain
3	PF14447 Prok-RING_4	1e+02	14.2	Prokaryotic RING finger family 4
4	PF13765 PRY	4.1e-19	79.3	SPRY-associated domain
5	PF00622 SPRY	3.4e-16	70.8	SPRY domain
6	PF04564 U-box	55	15.4	U-box domain
7	PF12861 zf-ANAPC11	7.3e+02	11.6	Anaphase-promoting complex subunit 11 RING-H2 finger
8	PF00643 zf-B_box	0.0001	33.7	B-box zinc finger
9	PF00097 zf-C3HC4	2.4e-07	41.8	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	4.6e-06	37.7	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	3.4e-05	34.9	Zinc finger, C3HC4 type (RING finger)
12	PF15227 zf-C3HC4_4	1.8e-06	39.3	zinc finger of C3HC4-type, RING
13	PF11789 zf-Nse	0.31	22.3	Zinc-finger of the MIZ type in Nse subunit
14	PF12678 zf-rbx1	17	17.1	RING-H2 zinc finger domain
15	PF16685 zf-RING_10	12	17.4	zinc RING finger of MSL2
16	PF13639 zf-RING_2	2.8e-06	38.9	Ring finger domain
17	PF14570 zf-RING_4	0.36	21.9	RING/Ubox like zinc-binding domain
18	PF14634 zf-RING_5	0.00042	31.5	zinc-RING finger domain
19	PF14835 zf-RING_6	0.0003	31.9	zf-RING of BARD1-type protein
20	PF13445 zf-RING_UBOX	3.7e-07	41.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356416	0.996	60 kDa SS-A/Ro ribonucleoprotein
2	9606.ENSP00000303709	0.988	Ubiquitin-conjugating enzyme E2 E1
3	9606.ENSP00000254322	0.971	DnaJ homolog subfamily B member 1
4	9606.ENSP00000374455	0.969	Sequestosome-1
5	9606.ENSP00000261769	0.965	Cadherin-1
6	9606.ENSP00000386636	0.961	Lupus La protein
7	9606.ENSP00000316176	0.960	Ubiquitin-conjugating enzyme E2 N
8	9606.ENSP00000471896	0.955	Interferon regulatory factor 3
9	9606.ENSP00000441543	0.942	Polyubiquitin-C
10	9606.ENSP00000304697	0.927	Polyubiquitin-B
11	9606.ENSP00000265560	0.923	Ubiquitin carboxyl-terminal hydrolase 4
12	9606.ENSP00000272317	0.923	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000388107	0.916	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000381717	0.886	Ubiquitin-conjugating enzyme E2 D2
15	9606.ENSP00000422753	0.843	Probable ATP-dependent RNA helicase DDX41
16	9606.ENSP00000282561	0.819	Gap junction alpha-1 protein
17	9606.ENSP00000302961	0.816	Heat shock protein family A member 4
18	9606.ENSP00000380697	0.811	Interferon regulatory factor 7
19	9606.ENSP00000269141	0.805	Cadherin-2
20	9606.ENSP00000263182	0.792	Gamma-butyrobetaine dioxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.990	catalytic activity
GO:0004842	0.967	ubiquitin-protein transferase activity
GO:0003713	0.949	transcription coactivator activity
GO:0042802	0.840	identical protein binding
GO:0061630	0.835	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048518	0.982	positive regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.979	response to stimulus
GO:0071704	0.974	organic substance metabolic process
GO:0044238	0.967	primary metabolic process
GO:0006807	0.951	nitrogen compound metabolic process
GO:0050792	0.951	regulation of viral process
GO:0080090	0.951	regulation of primary metabolic process
GO:0051171	0.945	regulation of nitrogen compound metabolic process
GO:0009987	0.921	cellular process
GO:0048519	0.921	negative regulation of biological process
GO:0010468	0.912	regulation of gene expression
GO:0043170	0.904	macromolecule metabolic process
GO:0048583	0.866	regulation of response to stimulus
GO:1903900	0.863	regulation of viral life cycle
GO:0070647	0.861	protein modification by small protein conjugation or removal
GO:0051707	0.860	response to other organism
GO:0016567	0.848	protein ubiquitination
GO:0006950	0.835	response to stress
GO:0031323	0.793	regulation of cellular metabolic process
GO:0000209	0.746	protein polyubiquitination
GO:0051239	0.736	regulation of multicellular organismal process
GO:0002376	0.668	immune system process
GO:0098542	0.626	defense response to other organism
GO:0031326	0.589	regulation of cellular biosynthetic process
GO:0019219	0.588	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.586	regulation of macromolecule biosynthetic process
GO:0043903	0.583	regulation of biological process involved in symbiotic interaction
GO:0048524	0.576	positive regulation of viral process
GO:0051716	0.563	cellular response to stimulus
GO:0051252	0.563	regulation of RNA metabolic process
GO:0048522	0.562	positive regulation of cellular process
GO:0044237	0.540	cellular metabolic process
GO:0002682	0.533	regulation of immune system process
GO:0080134	0.504	regulation of response to stress
GO:2001141	0.490	regulation of RNA biosynthetic process
GO:0009893	0.472	positive regulation of metabolic process
GO:0010604	0.459	positive regulation of macromolecule metabolic process
GO:0009966	0.445	regulation of signal transduction
GO:0048523	0.442	negative regulation of cellular process
GO:0051865	0.435	protein autoubiquitination
GO:0009615	0.411	response to virus
GO:0006355	0.406	regulation of DNA-templated transcription
GO:0065009	0.398	regulation of molecular function
GO:0048584	0.358	positive regulation of response to stimulus
GO:0006955	0.339	immune response
GO:0010605	0.335	negative regulation of macromolecule metabolic process
GO:0042221	0.331	response to chemical
GO:0031347	0.322	regulation of defense response
GO:0051246	0.322	regulation of protein metabolic process
GO:0051607	0.322	defense response to virus
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0048525	0.311	negative regulation of viral process
GO:0050776	0.305	regulation of immune response
GO:0032101	0.304	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.990	nucleoplasm
GO:0005829	0.966	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.972	Transferases.

[back to server]