StarFunc result for job id P19484

User Input

>input (476 residues)
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPA
ASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQM
PNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNH
NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELEN
HSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEAL
MLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0QYS7	0.285	0.248	2.395E-63	562	1.000	0.847	B0QYS7.pdb.gz	B0QYS7_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
2	AFDB:A0A2R8RRI1	0.325	0.316	3.308E-35	493	0.590	0.570	A0A2R8RRI1.pdb.gz	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
3	AFDB:O75030	0.271	0.247	2.050E-26	526	0.458	0.414	O75030.pdb.gz	MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens OX=9606 GN=MITF PE=1 SV=2
4	AFDB:M9MM95	0.301	0.269	2.495E-26	539	0.454	0.401	M9MM95.pdb.gz
5	AFDB:F1Q885	0.257	0.245	4.985E-23	500	0.408	0.388	F1Q885.pdb.gz	F1Q885_DANRE Melanocyte-inducing transcription factor b OS=Danio rerio OX=7955 GN=mitfb PE=2 SV=2
6	AFDB:Q9PWC2	0.250	0.285	1.715E-21	412	0.389	0.449	Q9PWC2.pdb.gz	Q9PWC2_DANRE Melanocyte-inducing transcription factor a OS=Danio rerio OX=7955 GN=nacre PE=2 SV=1
7	AFDB:A0A0J9YJK3	0.248	0.385	7.877E-16	299	0.309	0.492	A0A0J9YJK3.pdb.gz
8	AFDB:Q9WTW4	0.237	0.352	7.583E-12	317	0.296	0.445	Q9WTW4.pdb.gz	TFEC_MOUSE Transcription factor EC OS=Mus musculus OX=10090 GN=Tfec PE=1 SV=1
9	AFDB:Q63302	0.238	0.352	2.633E-11	317	0.305	0.457	Q63302.pdb.gz	TFEC_RAT Transcription factor EC OS=Rattus norvegicus OX=10116 GN=Tfec PE=1 SV=2
10	AFDB:C3KGP2	0.290	0.174	3.205E-11	837	0.296	0.168	C3KGP2.pdb.gz	C3KGP2_DROME MIP04163p OS=Drosophila melanogaster OX=7227 GN=Mitf PE=2 SV=1
11	PDB:7mqaNA	0.072	0.114	1.963E-1	295	0.076	0.122	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6zheC	0.064	0.046	1.597	705	0.057	0.038	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
13	PDB:3ojaA	0.178	0.176	2.216	482	0.038	0.037	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
14	PDB:2bskD	0.081	0.296	4.864	90	0.027	0.144	2bskD.pdb.gz
15	PDB:7lbmd	0.101	0.161	5.546	275	0.065	0.113	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
16	PDB:5n9jG	0.119	0.310	7.207	163	0.040	0.117	5n9jG.pdb.gz
17	PDB:7cgpJ	0.087	0.384	7.207	83	0.025	0.145	7cgpJ.pdb.gz
18	PDB:5wlcNB	0.081	0.241	7.695	142	0.046	0.155	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
19	PDB:6qdvP	0.048	0.148	7.695	106	0.011	0.047	6qdvP.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
20	PDB:5gm6P	0.077	0.148	8.216	246	0.061	0.118	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GXL9	0.0	546	267	0.561	1.000	A0A1B0GXL9_HUMAN Transcription factor EB (Fragment) OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
2	B0QYS6	0.0	966	490	1.000	0.971	B0QYS6_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
3	B0QYS7	0.0	966	562	1.000	0.847	B0QYS7_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
4	B1AKB4	0.0	548	268	0.563	1.000	B1AKB4_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
5	P19484	0.0	965	476	1.000	1.000	TFEB_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=3
6	Q9R210	0.0	754	475	0.935	0.937	TFEB_MOUSE Transcription factor EB OS=Mus musculus OX=10090 GN=Tfeb PE=1 SV=2
7	B1AKB2	8.49e-177	497	244	0.513	1.000	B1AKB2_HUMAN Transcription factor EB (Fragment) OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
8	B1AKB1	4.96e-159	451	222	0.466	1.000	B1AKB1_HUMAN Transcription factor EB (Fragment) OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=8
9	A0A2R8RRI1	1.09e-156	455	493	0.586	0.566	A0A2R8RRI1_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
10	G5CIM3	3.48e-156	454	493	0.584	0.564	G5CIM3_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=2 SV=1
11	E7FEM8	8.47e-154	448	491	0.584	0.566	E7FEM8_DANRE Transcription factor EB OS=Danio rerio OX=7955 GN=tfeb PE=3 SV=1
12	Q08874	4.41e-107	330	526	0.485	0.439	MITF_MOUSE Microphthalmia-associated transcription factor OS=Mus musculus OX=10090 GN=Mitf PE=1 SV=4
13	O88368	5.83e-107	329	526	0.479	0.433	MITF_RAT Microphthalmia-associated transcription factor OS=Rattus norvegicus OX=10116 GN=Mitf PE=2 SV=2
14	Q561Z2	7.55e-100	311	539	0.462	0.408	Q561Z2_DANRE Tfe3a protein OS=Danio rerio OX=7955 GN=cb873 PE=2 SV=1
15	O75030	4.32e-94	296	526	0.462	0.418	MITF_HUMAN Microphthalmia-associated transcription factor OS=Homo sapiens OX=9606 GN=MITF PE=1 SV=2
16	P19532	2.08e-92	293	575	0.332	0.275	TFE3_HUMAN Transcription factor E3 OS=Homo sapiens OX=9606 GN=TFE3 PE=1 SV=4
17	Q64092	4.43e-92	292	572	0.330	0.274	TFE3_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=2
18	A2AEW1	4.62e-92	292	572	0.330	0.274	A2AEW1_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=1
19	F1Q885	4.01e-91	288	500	0.355	0.338	F1Q885_DANRE Melanocyte-inducing transcription factor b OS=Danio rerio OX=7955 GN=mitfb PE=2 SV=2
20	Q9PWC2	9.04e-91	284	412	0.391	0.451	Q9PWC2_DANRE Melanocyte-inducing transcription factor a OS=Danio rerio OX=7955 GN=nacre PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11851 DUF3371	1.1e-31	122.0	Domain of unknown function (DUF3371)
2	PF00010 HLH	1.4e-11	55.5	Helix-loop-helix DNA-binding domain
3	PF15951 MITF_TFEB_C_3_N	2.6e-63	224.6	MITF/TFEB/TFEC/TFE3 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351742

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295600	0.967	Microphthalmia-associated transcription factor
2	9606.ENSP00000314129	0.965	Transcription factor E3
3	9606.ENSP00000253382	0.954	Acetyl-coenzyme A synthetase, cytoplasmic
4	9606.ENSP00000328777	0.899	Ephrin-A5
5	9606.ENSP00000306330	0.830	14-3-3 protein gamma
6	9606.ENSP00000361930	0.827	14-3-3 protein beta/alpha
7	9606.ENSP00000333298	0.818	Lysosome-associated membrane glycoprotein 1
8	9606.ENSP00000264079	0.801	Mucolipin-1
9	9606.ENSP00000307272	0.774	Regulatory-associated protein of mTOR
10	9606.ENSP00000374455	0.757	Sequestosome-1
11	9606.ENSP00000354558	0.754	Serine/threonine-protein kinase mTOR
12	9606.ENSP00000355231	0.752	Beclin-1
13	9606.ENSP00000325690	0.732	Histone-arginine methyltransferase CARM1
14	9606.ENSP00000408411	0.725	Lysosome-associated membrane glycoprotein 2
15	9606.ENSP00000346437	0.723	Ubiquitin-like modifier-activating enzyme ATG7
16	9606.ENSP00000268607	0.709	Microtubule-associated proteins 1A/1B light chain 3B
17	9606.ENSP00000362109	0.705	Fibroblast growth factor receptor substrate 3
18	9606.ENSP00000264255	0.702	Thioredoxin domain-containing protein 9
19	9606.ENSP00000236671	0.700	Cathepsin D
20	9606.ENSP00000358072	0.693	Autophagy protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000977	0.614	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.451	DNA-binding transcription activator activity
GO:0000987	0.410	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.405	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.398	enzyme binding
GO:0000978	0.364	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0080090	0.988	regulation of primary metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0010468	0.982	regulation of gene expression
GO:2001141	0.977	regulation of RNA biosynthetic process
GO:0006355	0.970	regulation of DNA-templated transcription
GO:0009893	0.940	positive regulation of metabolic process
GO:0031325	0.933	positive regulation of cellular metabolic process
GO:0051173	0.931	positive regulation of nitrogen compound metabolic process
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0031328	0.895	positive regulation of cellular biosynthetic process
GO:0045935	0.895	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.858	response to stimulus
GO:0006357	0.838	regulation of transcription by RNA polymerase II
GO:0045893	0.829	positive regulation of DNA-templated transcription
GO:0071840	0.734	cellular component organization or biogenesis
GO:0016043	0.703	cellular component organization
GO:0045944	0.500	positive regulation of transcription by RNA polymerase II
GO:0006950	0.443	response to stress
GO:0006996	0.437	organelle organization
GO:0008152	0.430	metabolic process
GO:0007033	0.360	vacuole organization
GO:0051716	0.344	cellular response to stimulus
GO:0051179	0.333	localization
GO:0071704	0.309	organic substance metabolic process
GO:0032502	0.300	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.850	intracellular membrane-bounded organelle
GO:0005634	0.827	nucleus
GO:0016020	0.596	membrane
GO:0070013	0.362	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]