StarFunc result for job id P19525

User Input

>input (551 residues)
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19525	1.000	1.000	2.908E-92	551	1.000	1.000	P19525.pdb.gz	E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 PE=1 SV=2
2	AFDB:Q03963	0.515	0.548	1.141E-59	515	0.579	0.619	Q03963.pdb.gz	E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus OX=10090 GN=Eif2ak2 PE=1 SV=2
3	AFDB:Q63184	0.493	0.528	2.324E-58	513	0.575	0.618	Q63184.pdb.gz	E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Eif2ak2 PE=1 SV=1
4	AFDB:A0A346QRN3	0.451	0.384	2.316E-40	654	0.350	0.295	A0A346QRN3.pdb.gz
5	AFDB:A0A0R4IHF6	0.447	0.364	2.854E-39	682	0.343	0.277	A0A0R4IHF6.pdb.gz
6	AFDB:A1ZBL7	0.399	0.230	2.637E-18	993	0.203	0.113	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
7	AFDB:Q9NIV1	0.429	0.209	7.260E-17	1162	0.250	0.119	Q9NIV1.pdb.gz	E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster OX=7227 GN=PEK PE=1 SV=2
8	PDB:7qwkH	0.390	0.799	7.485E-17	259	0.176	0.375	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
9	AFDB:G5EDL3	0.386	0.630	8.875E-17	326	0.129	0.218	G5EDL3.pdb.gz	G5EDL3_CAEEL Aurora kinase OS=Caenorhabditis elegans OX=6239 GN=air-1 PE=1 SV=1
10	AFDB:B3DIV5	0.363	0.312	1.793E-16	648	0.185	0.157	B3DIV5.pdb.gz
11	AFDB:Q9LT35	0.396	0.517	1.793E-16	416	0.143	0.190	Q9LT35.pdb.gz	NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana OX=3702 GN=NEK6 PE=3 SV=1
12	PDB:7qwkE	0.376	0.829	2.260E-16	241	0.167	0.382	7qwkE.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
13	PDB:4zhxA	0.387	0.514	3.766E-15	409	0.138	0.186	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:4eomC	0.380	0.728	3.960E-15	276	0.122	0.243	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
15	PDB:6b1uA	0.387	0.476	4.164E-15	442	0.140	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:4krcA	0.380	0.676	7.236E-15	297	0.134	0.249	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:4rerA	0.387	0.459	7.236E-15	459	0.145	0.174	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:5ufuA	0.395	0.575	9.781E-15	369	0.143	0.214	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:1unlA	0.363	0.665	1.390E-14	292	0.132	0.250	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:8dksA	0.371	0.690	1.462E-14	283	0.114	0.223	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19525	0.0	1138	551	1.000	1.000	E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 PE=1 SV=2
2	Q03963	0.0	568	515	0.566	0.606	E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus OX=10090 GN=Eif2ak2 PE=1 SV=2
3	Q63184	0.0	570	513	0.581	0.624	E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Eif2ak2 PE=1 SV=1
4	A9YT50	8.80e-73	247	682	0.365	0.295	A9YT50_DANRE Double-stranded RNA activated protein kinase OS=Danio rerio OX=7955 GN=pkr PE=2 SV=1
5	Q0H740	4.78e-59	206	513	0.243	0.261	Q0H740_SALSA DsRNA activated Z-DNA binding protein kinase OS=Salmo salar OX=8030 GN=PKZ PE=2 SV=1
6	Q5NE12	3.16e-58	204	511	0.230	0.249	Q5NE12_DANRE Z-DNA binding protein kinase OS=Danio rerio OX=7955 GN=pkz PE=1 SV=1
7	Q5NE14	1.98e-57	202	511	0.229	0.247	Q5NE14_DANRE Interferon-induced, double-stranded RNA-activated protein kinase OS=Danio rerio OX=7955 GN=zgc:136657 PE=1 SV=1
8	Q5M813	3.04e-38	144	309	0.156	0.278	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
9	Q4WU06	4.18e-38	152	1592	0.200	0.069	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
10	Q9Z1J2	1.39e-36	147	792	0.158	0.110	NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1
11	F4J8A5	2.97e-36	146	1265	0.203	0.089	F4J8A5_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=GCN2 PE=1 SV=1
12	A0A8I5ZKL8	4.53e-36	145	743	0.156	0.116	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
13	A0A8I5ZLB3	4.75e-36	145	756	0.156	0.114	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
14	D3ZDV9	5.08e-36	145	793	0.156	0.108	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
15	A0A8I6A574	5.84e-36	145	829	0.156	0.104	A0A8I6A574_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
16	P51957	1.87e-35	144	841	0.158	0.103	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
17	Q9Z2B5	2.22e-34	140	1114	0.136	0.067	E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus OX=10090 GN=Eif2ak3 PE=1 SV=1
18	Q9Z1Z1	3.68e-34	140	1108	0.136	0.068	E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus OX=10116 GN=Eif2ak3 PE=1 SV=1
19	Q9NZJ5	8.18e-34	139	1116	0.136	0.067	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
20	Q9NIV1	1.33e-33	138	1162	0.143	0.068	E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster OX=7227 GN=PEK PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.014	26.0	ABC1 atypical kinase-like domain
2	PF14709 DND1_DSRM	56	15.5	double strand RNA binding domain from DEAD END PROTEIN 1
3	PF00035 dsrm	1.2e-24	98.1	Double-stranded RNA binding motif
4	PF13095 FTA2	1.3e+02	13.6	Kinetochore Sim4 complex subunit FTA2
5	PF06293 Kdo	84	14.0	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.12	23.3	Kinase-like
7	PF00069 Pkinase	8.2e-51	184.5	Protein kinase domain
8	PF17667 Pkinase_fungal	20	15.5	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	8.2e-33	125.4	Protein tyrosine and serine/threonine kinase
10	PF05445 Pox_ser-thr_kin	3.5e+02	11.6	Poxvirus serine/threonine protein kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.997	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000318176	0.994	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
3	9606.ENSP00000473631	0.984	DnaJ homolog subfamily C member 3
4	9606.ENSP00000264657	0.982	Signal transducer and activator of transcription 3
5	9606.ENSP00000264350	0.978	E3 ISG15--protein ligase HERC5
6	9606.ENSP00000269305	0.977	Cellular tumor antigen p53
7	9606.ENSP00000360869	0.971	Interferon-induced protein with tetratricopeptide repeats 1
8	9606.ENSP00000417229	0.970	Eukaryotic translation initiation factor 2A
9	9606.ENSP00000433623	0.969	TNF receptor-associated factor 6
10	9606.ENSP00000215794	0.967	Ubl carboxyl-terminal hydrolase 18
11	9606.ENSP00000381601	0.947	Interferon-induced GTP-binding protein Mx1
12	9606.ENSP00000304895	0.942	Insulin receptor substrate 1
13	9606.ENSP00000376445	0.941	Toll/interleukin-1 receptor domain-containing adapter protein
14	9606.ENSP00000323889	0.939	E3 ubiquitin/ISG15 ligase TRIM25
15	9606.ENSP00000363089	0.934	Toll-like receptor 4
16	9606.ENSP00000401399	0.934	Myeloid differentiation primary response protein MyD88
17	9606.ENSP00000354394	0.933	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000287156	0.931	Ubiquitin/ISG15-conjugating enzyme E2 L6
19	9606.ENSP00000368699	0.931	Ubiquitin-like protein ISG15
20	9606.ENSP00000414922	0.929	Putative ubiquitin carboxyl-terminal hydrolase 41

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0003725	0.998	double-stranded RNA binding
GO:0019208	0.897	phosphatase regulator activity
GO:0045182	0.889	translation regulator activity
GO:0004694	0.876	eukaryotic translation initiation factor 2alpha kinase activity
GO:0019888	0.866	protein phosphatase regulator activity
GO:0042802	0.863	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0009987	0.988	cellular process
GO:0044238	0.988	primary metabolic process
GO:0048518	0.982	positive regulation of biological process
GO:0044237	0.973	cellular metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:0043170	0.930	macromolecule metabolic process
GO:0048522	0.919	positive regulation of cellular process
GO:0019538	0.912	protein metabolic process
GO:0042221	0.902	response to chemical
GO:0019222	0.897	regulation of metabolic process
GO:0043412	0.856	macromolecule modification
GO:0009605	0.855	response to external stimulus
GO:0036211	0.852	protein modification process
GO:0051716	0.843	cellular response to stimulus
GO:0010646	0.782	regulation of cell communication
GO:0023051	0.779	regulation of signaling
GO:0031323	0.770	regulation of cellular metabolic process
GO:0048523	0.767	negative regulation of cellular process
GO:0080090	0.764	regulation of primary metabolic process
GO:0006950	0.761	response to stress
GO:0010468	0.741	regulation of gene expression
GO:0044419	0.729	biological process involved in interspecies interaction between organisms
GO:0009607	0.727	response to biotic stimulus
GO:0051171	0.721	regulation of nitrogen compound metabolic process
GO:0048583	0.711	regulation of response to stimulus
GO:0010033	0.691	response to organic substance
GO:0016310	0.628	phosphorylation
GO:0006468	0.617	protein phosphorylation
GO:0010556	0.606	regulation of macromolecule biosynthetic process
GO:0051707	0.595	response to other organism
GO:0007154	0.566	cell communication
GO:0031667	0.547	response to nutrient levels
GO:0009966	0.530	regulation of signal transduction
GO:0031326	0.481	regulation of cellular biosynthetic process
GO:0009893	0.459	positive regulation of metabolic process
GO:0048584	0.445	positive regulation of response to stimulus
GO:0051246	0.430	regulation of protein metabolic process
GO:0051252	0.425	regulation of RNA metabolic process
GO:0009615	0.419	response to virus
GO:0010604	0.412	positive regulation of macromolecule metabolic process
GO:0023052	0.404	signaling
GO:0065009	0.387	regulation of molecular function
GO:0031325	0.352	positive regulation of cellular metabolic process
GO:0009892	0.335	negative regulation of metabolic process
GO:0006952	0.334	defense response
GO:0006355	0.332	regulation of DNA-templated transcription
GO:1902531	0.331	regulation of intracellular signal transduction
GO:0009967	0.331	positive regulation of signal transduction
GO:0010605	0.329	negative regulation of macromolecule metabolic process
GO:0044093	0.321	positive regulation of molecular function
GO:0070887	0.319	cellular response to chemical stimulus
GO:0007165	0.319	signal transduction
GO:0080134	0.316	regulation of response to stress
GO:0051173	0.300	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0005829	0.993	cytosol
GO:0016020	0.990	membrane
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0070013	0.940	intracellular organelle lumen
GO:0005634	0.927	nucleus
GO:0032991	0.921	protein-containing complex
GO:0031981	0.467	nuclear lumen
GO:0048471	0.455	perinuclear region of cytoplasm
GO:0005840	0.400	ribosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]