StarFunc result for job id P19526

User Input

>input (365 residues)
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGT
AMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAAL
APVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQ
IRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSA
YLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQC
NHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLW
TLAKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19526	1.000	1.000	3.718E-80	365	1.000	1.000	P19526.pdb.gz	FUT1_HUMAN Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
2	AFDB:F6Q1T7	0.849	0.861	3.899E-66	360	0.770	0.781	F6Q1T7.pdb.gz	FUT1_BOVIN Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Bos taurus OX=9913 GN=FUT1 PE=1 SV=1
3	AFDB:O09160	0.874	0.847	6.978E-65	377	0.778	0.753	O09160.pdb.gz	FUT1_MOUSE Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2
4	AFDB:Q28113	0.765	0.812	7.553E-52	344	0.562	0.596	Q28113.pdb.gz	FUT2_BOVIN Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=FUT2 PE=1 SV=2
5	AFDB:Q10981	0.767	0.816	3.002E-50	343	0.556	0.592	Q10981.pdb.gz	FUT2_HUMAN Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Homo sapiens OX=9606 GN=FUT2 PE=1 SV=1
6	AFDB:Q10984	0.767	0.791	4.613E-50	354	0.548	0.565	Q10984.pdb.gz	FUT2_RAT Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Fut2 PE=1 SV=2
7	AFDB:Q9TTY3	0.778	0.772	1.193E-48	368	0.504	0.500	Q9TTY3.pdb.gz	SEC1_BOVIN Galactoside 2-alpha-L-fucosyltransferase SEC1 OS=Bos taurus OX=9913 GN=SEC1 PE=1 SV=1
8	AFDB:P97353	0.746	0.740	1.885E-45	368	0.496	0.492	P97353.pdb.gz	SEC1_MOUSE Galactoside 2-alpha-L-fucosyltransferase Sec1 OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1
9	AFDB:P91200	0.589	0.604	4.187E-14	355	0.170	0.175	P91200.pdb.gz	FUTB1_CAEEL Galactoside 2-alpha-L-fucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=fut-2 PE=1 SV=1
10	AFDB:Q10017	0.557	0.613	1.718E-13	327	0.184	0.205	Q10017.pdb.gz	YSW1_CAEEL Uncharacterized protein T25D10.1 OS=Caenorhabditis elegans OX=6239 GN=T25D10.1 PE=4 SV=2
11	PDB:5kxqA	0.437	0.481	6.484E-8	327	0.151	0.168	5kxqA.pdb.gz	Recognition of EGF-like domains by the Notch-modifying O-fucosyltransferase POFUT1.
12	PDB:5ky2A	0.450	0.460	7.794E-8	355	0.145	0.149	5ky2A.pdb.gz	Recognition of EGF-like domains by the Notch-modifying O-fucosyltransferase POFUT1.
13	PDB:6x5hA	0.447	0.361	3.007E-7	467	0.115	0.090	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
14	PDB:3zy5A	0.403	0.411	2.823E-5	356	0.140	0.143	3zy5A.pdb.gz	Structural Insights Into the Mechanism of Protein O-Fucosylation.
15	PDB:8ay1A	0.368	0.328	4.338E-5	421	0.112	0.097	8ay1A.pdb.gz
16	PDB:4ap6A	0.358	0.341	5.545E-5	389	0.112	0.105	4ap6A.pdb.gz	Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
17	PDB:1pswA	0.402	0.434	2.572E-4	331	0.077	0.085	1pswA.pdb.gz
18	PDB:3okaA	0.310	0.303	6.867E-4	378	0.115	0.111	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
19	PDB:4rapE	0.331	0.313	7.301E-4	390	0.107	0.100	4rapE.pdb.gz	A structural mechanism for bacterial autotransporter glycosylation by a dodecameric heptosyltransferase family.
20	PDB:6j7kA	0.363	0.347	1.622E-3	385	0.121	0.114	6j7kA.pdb.gz	Complex Structure ofPseudomonas aeruginosaArginine Rhamnosyltransferase EarP with Its Acceptor Elongation Factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6Q1T7	0.0	588	360	0.770	0.781	FUT1_BOVIN Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Bos taurus OX=9913 GN=FUT1 PE=1 SV=1
2	O09160	0.0	576	377	0.775	0.751	FUT1_MOUSE Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2
3	P19526	0.0	755	365	1.000	1.000	FUT1_HUMAN Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
4	Q10981	4.31e-148	423	343	0.545	0.580	FUT2_HUMAN Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Homo sapiens OX=9606 GN=FUT2 PE=1 SV=1
5	Q9JL27	3.16e-145	416	347	0.534	0.562	FUT2_MOUSE Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Mus musculus OX=10090 GN=Fut2 PE=1 SV=1
6	Q28113	7.04e-145	415	344	0.529	0.561	FUT2_BOVIN Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=FUT2 PE=1 SV=2
7	Q10984	2.56e-143	412	354	0.532	0.548	FUT2_RAT Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Fut2 PE=1 SV=2
8	Q9TTY3	1.01e-131	383	368	0.479	0.476	SEC1_BOVIN Galactoside 2-alpha-L-fucosyltransferase SEC1 OS=Bos taurus OX=9913 GN=SEC1 PE=1 SV=1
9	P97353	3.43e-127	371	368	0.466	0.462	SEC1_MOUSE Galactoside 2-alpha-L-fucosyltransferase Sec1 OS=Mus musculus OX=10090 GN=Sec1 PE=2 SV=1
10	Q966A0	4.01e-05	47.4	364	0.175	0.176	SVH11_CAEEL Putative galactoside 2-alpha-L-fucosyltransferase svh-11 OS=Caenorhabditis elegans OX=6239 GN=svh-11 PE=3 SV=1
11	P91200	0.023	38.9	355	0.129	0.132	FUTB1_CAEEL Galactoside 2-alpha-L-fucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=fut-2 PE=1 SV=1
12	Q9P2G1	0.12	37.0	1089	0.066	0.022	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
13	Q38FH1	0.13	36.2	308	0.178	0.211	Q38FH1_TRYB2 Alpha-1,2-fucosyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2220 PE=4 SV=1
14	P06882	0.40	35.4	2768	0.068	0.009	THYG_RAT Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg PE=1 SV=4
15	Q57WN9	1.8	33.1	648	0.052	0.029	Q57WN9_TRYB2 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.980 PE=4 SV=1
16	Q6AZA4	1.9	32.3	188	0.044	0.085	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
17	A0A2R8Q8S1	2.0	32.3	189	0.044	0.085	A0A2R8Q8S1_DANRE GTPase KRas isoform X1 OS=Danio rerio OX=7955 GN=wu:fa04e08 PE=1 SV=1
18	P08644	2.2	32.0	189	0.044	0.085	RASK_RAT GTPase KRas OS=Rattus norvegicus OX=10116 GN=Kras PE=1 SV=3
19	P32883	2.2	32.0	189	0.044	0.085	RASK_MOUSE GTPase KRas OS=Mus musculus OX=10090 GN=Kras PE=1 SV=1
20	P01116	2.3	32.0	189	0.044	0.085	RASK_HUMAN GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01531 Glyco_transf_11	8.2e-136	463.6	Glycosyl transferase family 11
2	PF10250 O-FucT	5.5	18.2	GDP-fucose protein O-fucosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312021

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305603	0.985	Galactoside 3(4)-L-fucosyltransferase
2	9606.ENSP00000466880	0.979	Alpha-(1,3)-fucosyltransferase 5
3	9606.ENSP00000302599	0.977	Alpha-(1,3)-fucosyltransferase 9
4	9606.ENSP00000351602	0.977	Alpha-(1,3)-fucosyltransferase 4
5	9606.ENSP00000313398	0.976	Alpha-(1,3)-fucosyltransferase 6
6	9606.ENSP00000381699	0.962	Beta-1,3-galactosyltransferase 5
7	9606.ENSP00000428540	0.954	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
8	9606.ENSP00000436047	0.954	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
9	9606.ENSP00000319636	0.950	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
10	9606.ENSP00000262915	0.948	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
11	9606.ENSP00000321874	0.948	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
12	9606.ENSP00000368917	0.948	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
13	9606.ENSP00000376456	0.947	Beta-1,3-galactosyltransferase 1
14	9606.ENSP00000480884	0.946	Type 2 lactosamine alpha-2,3-sialyltransferase
15	9606.ENSP00000377257	0.944	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
16	9606.ENSP00000305595	0.942	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
17	9606.ENSP00000310696	0.940	Beta-1,4-galactosyltransferase 2
18	9606.ENSP00000369055	0.939	Beta-1,4-galactosyltransferase 1
19	9606.ENSP00000356404	0.929	Beta-1,3-galactosyltransferase 2
20	9606.ENSP00000420161	0.926	Beta-1,4-galactosyltransferase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008107	1.000	galactoside 2-alpha-L-fucosyltransferase activity
GO:0005515	0.429	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0044238	0.986	primary metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:1901564	0.962	organonitrogen compound metabolic process
GO:1901576	0.961	organic substance biosynthetic process
GO:0070085	0.960	glycosylation
GO:0044249	0.960	cellular biosynthetic process
GO:1901135	0.959	carbohydrate derivative metabolic process
GO:0043170	0.943	macromolecule metabolic process
GO:1901137	0.883	carbohydrate derivative biosynthetic process
GO:0019538	0.879	protein metabolic process
GO:1901566	0.869	organonitrogen compound biosynthetic process
GO:0036211	0.867	protein modification process
GO:0009059	0.864	macromolecule biosynthetic process
GO:0009100	0.837	glycoprotein metabolic process
GO:0009101	0.828	glycoprotein biosynthetic process
GO:0006486	0.806	protein glycosylation
GO:0016051	0.790	carbohydrate biosynthetic process
GO:0009311	0.779	oligosaccharide metabolic process
GO:0009312	0.754	oligosaccharide biosynthetic process
GO:0065007	0.453	biological regulation
GO:0050789	0.443	regulation of biological process
GO:0050794	0.421	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005886	0.953	plasma membrane
GO:0005576	0.692	extracellular region
GO:0031982	0.637	vesicle
GO:0043230	0.527	extracellular organelle
GO:0070062	0.521	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:50664	1.000	a beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-L-Fuc-(1->2)-beta-D-Gal-(1->3)-beta-D-GlcNAc derivative + GDP + H(+)
EC:2.4.1.69	1.000	type 1 galactoside alpha-(1,2)-fucosyltransferase.

[back to server]