StarFunc result for job id P19544

User Input

>input (449 residues)
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA
SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED
PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV
RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC
ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS
CQKKFARSDELVRHHNMHQRNMTKLQLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MT54	0.338	0.294	1.521E-63	522	1.000	0.860	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
2	AFDB:Q9PUT7	0.330	0.353	1.127E-47	419	0.717	0.768	Q9PUT7.pdb.gz	Q9PUT7_DANRE WT1 transcription factor a OS=Danio rerio OX=7955 GN=wt1 PE=2 SV=1
3	AFDB:Q9VI93	0.244	0.118	4.818E-13	946	0.241	0.114	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
4	AFDB:Q96T25	0.247	0.173	8.206E-13	663	0.247	0.167	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
5	AFDB:Q54ET8	0.290	0.165	9.374E-13	810	0.200	0.111	Q54ET8.pdb.gz	Q54ET8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291342 PE=4 SV=2
6	AFDB:Q8K1M4	0.236	0.136	1.308E-12	789	0.229	0.131	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
7	AFDB:R9PY21	0.194	0.124	3.192E-11	720	0.232	0.144	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
8	AFDB:O75626	0.273	0.160	8.104E-11	825	0.212	0.115	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
9	AFDB:P11161	0.209	0.198	1.577E-10	476	0.234	0.221	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
10	AFDB:A0A096MJU6	0.234	0.125	1.925E-10	857	0.203	0.106	A0A096MJU6.pdb.gz	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
11	PDB:7dvqM	0.041	0.071	2.910	191	0.056	0.131	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:6bk8O	0.072	0.116	3.797	229	0.018	0.035	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	PDB:6tedV	0.047	0.073	4.059	244	0.036	0.066	6tedV.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	PDB:7fikP	0.075	0.061	4.059	593	0.022	0.017	7fikP.pdb.gz
15	PDB:7od1A	0.050	0.051	4.059	430	0.036	0.037	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:5xbtA	0.070	0.105	4.637	271	0.022	0.037	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
17	PDB:6htsR	0.040	0.188	6.913	72	0.031	0.194	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
18	PDB:5c8dE	0.047	0.071	7.388	280	0.020	0.032	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:7ad8D	0.054	0.077	7.897	280	0.029	0.046	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
20	PDB:5datC0	0.053	0.150	8.440	96	0.009	0.042	5datC0.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT54	0.0	931	522	1.000	0.860	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
2	A0A1W2PQQ0	0.0	885	505	0.962	0.855	A0A1W2PQQ0_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
3	A0A1W2PR07	0.0	590	297	0.635	0.960	A0A1W2PR07_HUMAN WT1 transcription factor OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
4	A9CSE6	0.0	718	416	0.784	0.846	A9CSE6_GLARU Wilms tumor 1 +KTS isoform OS=Glandirana rugosa OX=8410 GN=WT1 +KTS isoform PE=2 SV=1
5	A9CSE8	0.0	709	413	0.780	0.847	A9CSE8_GLARU Wilms tumor 1-KTS isoform OS=Glandirana rugosa OX=8410 GN=WT1 -KTS isoform PE=2 SV=1
6	B7ZSG3	0.0	710	414	0.782	0.848	WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis OX=8355 GN=wt1-a PE=2 SV=1
7	H0Y7K5	0.0	919	519	0.993	0.859	H0Y7K5_HUMAN WT1 transcription factor OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=3
8	J3KNN9	0.0	875	502	0.955	0.855	J3KNN9_HUMAN WT1 transcription factor OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=3
9	P19544	0.0	929	449	1.000	1.000	WT1_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
10	P22561	0.0	890	449	0.964	0.964	WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus OX=10090 GN=Wt1 PE=1 SV=1
11	P49952	0.0	899	448	0.969	0.971	WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus OX=10116 GN=Wt1 PE=2 SV=1
12	P79958	0.0	694	407	0.775	0.855	WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis OX=8355 GN=wt1-b PE=2 SV=1
13	Q08CU4	0.0	537	404	0.635	0.705	Q08CU4_DANRE WT1 transcription factor b OS=Danio rerio OX=7955 GN=wt1 PE=2 SV=1
14	Q9I8A0	0.0	747	417	0.844	0.909	Q9I8A0_CHICK WT1(+KTS) protein OS=Gallus gallus OX=9031 GN=WT1(+KTS) PE=2 SV=1
15	Q9PUT7	0.0	614	419	0.722	0.773	Q9PUT7_DANRE WT1 transcription factor a OS=Danio rerio OX=7955 GN=wt1 PE=2 SV=1
16	H0YED9	4.94e-101	301	178	0.350	0.882	H0YED9_HUMAN WT1 transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=1
17	A0S0R1	3.94e-30	121	343	0.118	0.155	A0S0R1_DANRE Krueppel-like factor 8 OS=Danio rerio OX=7955 GN=si:ch211-208m1.2 PE=2 SV=1
18	P26632	4.73e-30	124	511	0.129	0.114	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
19	O08876	6.30e-30	123	480	0.125	0.117	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
20	P18146	6.54e-30	124	543	0.147	0.122	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6e+02	12.2	Immunoglobulin C1-set domain
2	PF16159 FOXP-CC	0.7	21.7	FOXP coiled-coil domain
3	PF02165 WT1	5.2e-148	503.5	Wilm's tumour protein
4	PF00096 zf-C2H2	4.8e-11	53.6	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	0.0012	30.5	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	87	14.9	C2H2-type zinc ribbon
7	PF17017 zf-C2H2_aberr	17	17.0	Aberrant zinc-finger
8	PF13465 zf-H2C2_2	1.7e-10	52.0	Zinc-finger double domain
9	PF12874 zf-met	81	15.0	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
2	9606.ENSP00000351141	0.993	Pre-mRNA-splicing regulator WTAP
3	9606.ENSP00000328088	0.987	PRKC apoptosis WT1 regulator protein
4	9606.ENSP00000442788	0.981	Methylcytosine dioxygenase TET2
5	9606.ENSP00000307863	0.975	Splicing factor U2AF 65 kDa subunit
6	9606.ENSP00000309572	0.949	Telomerase reverse transcriptase
7	9606.ENSP00000367545	0.947	Tumor protein p73
8	9606.ENSP00000334458	0.946	Transcription factor GATA-4
9	9606.ENSP00000362690	0.942	Steroidogenic factor 1
10	9606.ENSP00000262375	0.901	DnaJ homolog subfamily A member 3, mitochondrial
11	9606.ENSP00000319281	0.876	Brain abundant membrane attached signal protein 1
12	9606.ENSP00000444198	0.868	Cbp/p300-interacting transactivator 2
13	9606.ENSP00000368190	0.857	Nephrin
14	9606.ENSP00000466953	0.856	Wilms tumor protein 1-interacting protein
15	9606.ENSP00000358677	0.854	T-box transcription factor TBX18
16	9606.ENSP00000356587	0.850	Podocin
17	9606.ENSP00000384179	0.850	Zinc finger protein ZFPM2
18	9606.ENSP00000377789	0.824	Synaptopodin
19	9606.ENSP00000368253	0.818	Nuclear receptor subfamily 0 group B member 1
20	9606.ENSP00000359319	0.817	Paired box protein Pax-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.998	sequence-specific DNA binding
GO:0005515	0.997	protein binding
GO:0003690	0.997	double-stranded DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:1990837	0.975	sequence-specific double-stranded DNA binding
GO:0000978	0.942	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.939	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.725	DNA-binding transcription activator activity
GO:0001228	0.643	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0048522	0.991	positive regulation of cellular process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0051254	0.981	positive regulation of RNA metabolic process
GO:0010557	0.980	positive regulation of macromolecule biosynthetic process
GO:0006357	0.970	regulation of transcription by RNA polymerase II
GO:0009987	0.942	cellular process
GO:0045893	0.938	positive regulation of DNA-templated transcription
GO:0032502	0.881	developmental process
GO:0045944	0.877	positive regulation of transcription by RNA polymerase II
GO:0032501	0.864	multicellular organismal process
GO:0048856	0.851	anatomical structure development
GO:0007275	0.726	multicellular organism development
GO:0048731	0.675	system development
GO:0048513	0.635	animal organ development
GO:0050896	0.570	response to stimulus
GO:0048519	0.492	negative regulation of biological process
GO:0048523	0.481	negative regulation of cellular process
GO:0051716	0.436	cellular response to stimulus
GO:0009892	0.408	negative regulation of metabolic process
GO:0010605	0.371	negative regulation of macromolecule metabolic process
GO:0030154	0.339	cell differentiation
GO:0051172	0.308	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.970	cytosol
GO:0016604	0.346	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]