StarFunc result for job id P19622

User Input

>input (333 residues)
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNH
QHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQ
LLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGS
LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNP
NKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIK
KATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19622	1.000	1.000	4.108E-48	333	1.000	1.000	P19622.pdb.gz	HME2_HUMAN Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3
2	AFDB:P50222	0.207	0.224	2.715E-7	304	0.201	0.220	P50222.pdb.gz	MEOX2_HUMAN Homeobox protein MOX-2 OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=2
3	AFDB:P06798	0.185	0.215	2.295E-6	285	0.207	0.242	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
4	AFDB:P09013	0.187	0.222	6.056E-6	276	0.195	0.236	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
5	AFDB:Q9YH70	0.183	0.182	1.705E-5	334	0.192	0.192	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
6	AFDB:F1QUC3	0.166	0.176	1.940E-5	312	0.174	0.186	F1QUC3.pdb.gz
7	AFDB:P31275	0.178	0.210	1.940E-5	282	0.222	0.262	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
8	AFDB:P23812	0.183	0.226	2.681E-5	268	0.186	0.231	P23812.pdb.gz	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
9	AFDB:P35452	0.176	0.211	3.705E-5	270	0.180	0.222	P35452.pdb.gz	HXD12_HUMAN Homeobox protein Hox-D12 OS=Homo sapiens OX=9606 GN=HOXD12 PE=1 SV=3
10	AFDB:Q6W990	0.183	0.196	1.351E-4	310	0.198	0.213	Q6W990.pdb.gz	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
11	PDB:4egcA	0.154	0.096	2.214E-2	539	0.036	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.159	0.623	5.133E-2	73	0.042	0.192	2hi3A.pdb.gz
13	PDB:1yioA	0.108	0.166	1.582	198	0.039	0.066	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
14	PDB:7fbyA	0.124	0.242	1.582	153	0.021	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:2vbwA	0.089	0.173	1.801	147	0.036	0.082	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
16	PDB:7n9sA	0.093	0.020	2.050	2365	0.036	0.005	7n9sA.pdb.gz
17	PDB:2cjjA	0.154	0.691	2.333	63	0.024	0.127	2cjjA.pdb.gz
18	PDB:5aj0BZ	0.125	0.408	2.333	86	0.024	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:1tq6A	0.073	0.062	2.489	402	0.030	0.025	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
20	PDB:4pcqB	0.118	0.238	3.224	149	0.018	0.040	4pcqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19622	0.0	663	333	1.000	1.000	HME2_HUMAN Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3
2	P09066	1.37e-157	446	324	0.847	0.870	HME2_MOUSE Homeobox protein engrailed-2 OS=Mus musculus OX=10090 GN=En2 PE=2 SV=2
3	D3Z8B1	1.69e-157	445	323	0.859	0.885	D3Z8B1_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En2 PE=3 SV=1
4	Q05917	3.44e-103	306	289	0.616	0.709	HME2_CHICK Homeobox protein engrailed-2 OS=Gallus gallus OX=9031 GN=EN2 PE=1 SV=2
5	P31533	2.60e-97	290	261	0.511	0.651	HME2B_DANRE Homeobox protein engrailed-2b OS=Danio rerio OX=7955 GN=eng2b PE=2 SV=2
6	P09015	3.03e-92	277	265	0.489	0.615	HME2A_DANRE Homeobox protein engrailed-2a OS=Danio rerio OX=7955 GN=eng2a PE=2 SV=2
7	Q04896	3.62e-66	209	231	0.297	0.429	HME1A_DANRE Homeobox protein engrailed-1a OS=Danio rerio OX=7955 GN=eng1a PE=2 SV=1
8	P09065	7.75e-65	212	401	0.318	0.264	HME1_MOUSE Homeobox protein engrailed-1 OS=Mus musculus OX=10090 GN=En1 PE=2 SV=3
9	A0A0G2JT82	1.25e-64	211	402	0.318	0.264	A0A0G2JT82_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En1 PE=3 SV=2
10	Q5BJ08	2.56e-64	206	274	0.318	0.387	Q5BJ08_DANRE Homeobox protein engrailed-like OS=Danio rerio OX=7955 GN=zgc:113499 PE=2 SV=1
11	Q05925	2.77e-64	210	392	0.318	0.270	HME1_HUMAN Homeobox protein engrailed-1 OS=Homo sapiens OX=9606 GN=EN1 PE=3 SV=3
12	P02836	1.02e-54	189	552	0.270	0.163	HMEN_DROME Segmentation polarity homeobox protein engrailed OS=Drosophila melanogaster OX=7227 GN=en PE=1 SV=2
13	P05527	3.13e-48	172	576	0.258	0.149	HMIN_DROME Homeobox protein invected OS=Drosophila melanogaster OX=7227 GN=inv PE=2 SV=2
14	P34326	3.08e-37	134	187	0.192	0.342	HM16_CAEEL Homeobox protein engrailed-like ceh-16 OS=Caenorhabditis elegans OX=6239 GN=ceh-16 PE=1 SV=3
15	Q8MZ02	1.65e-17	84.7	378	0.117	0.103	Q8MZ02_DROME Lateral muscles scarcer, isoform B OS=Drosophila melanogaster OX=7227 GN=lms PE=2 SV=1
16	P10628	7.83e-16	78.2	250	0.117	0.156	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
17	P10284	9.07e-16	77.8	250	0.117	0.156	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
18	Q08624	1.02e-15	78.2	264	0.117	0.148	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
19	P17483	1.05e-15	77.8	251	0.117	0.155	HXB4_HUMAN Homeobox protein Hox-B4 OS=Homo sapiens OX=9606 GN=HOXB4 PE=1 SV=2
20	P09017	1.06e-15	77.8	264	0.117	0.148	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04218 CENP-B_N	1.5e+02	13.5	CENP-B N-terminal DNA-binding domain
2	PF10078 DUF2316	1.2e+02	14.4	Uncharacterized protein conserved in bacteria (DUF2316)
3	PF10525 Engrail_1_C_sig	2.2e-14	63.6	Engrailed homeobox C-terminal signature domain
4	PF05920 Homeobox_KN	11	17.3	Homeobox KN domain
5	PF00046 Homeodomain	4.2e-18	76.3	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.826	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000365720	0.780	Transducin-like enhancer protein 4
3	9606.ENSP00000293549	0.772	Proto-oncogene Wnt-1
4	9606.ENSP00000242480	0.759	E3 SUMO-protein ligase EGR2
5	9606.ENSP00000321797	0.736	Fibroblast growth factor 8
6	9606.ENSP00000452871	0.731	Transducin-like enhancer protein 3
7	9606.ENSP00000359319	0.720	Paired box protein Pax-2
8	9606.ENSP00000365682	0.712	Transducin-like enhancer protein 1
9	9606.ENSP00000266991	0.652	Desert hedgehog protein
10	9606.ENSP00000233535	0.649	Zinc transporter 3
11	9606.ENSP00000425561	0.648	Eukaryotic translation initiation factor 4E
12	9606.ENSP00000297261	0.629	Sonic hedgehog protein
13	9606.ENSP00000316578	0.625	Polycomb protein SUZ12
14	9606.ENSP00000249501	0.604	Homeobox protein Hox-D10
15	9606.ENSP00000295206	0.597	Homeobox protein engrailed-1
16	9606.ENSP00000339004	0.583	Forkhead box protein G1
17	9606.ENSP00000350844	0.578	Paired box protein Pax-5
18	9606.ENSP00000260653	0.565	Homeobox protein SIX3
19	9606.ENSP00000453793	0.558	Homeobox protein Meis2
20	9606.ENSP00000317439	0.557	Canopy FGF signaling regulator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.959	protein binding
GO:0140110	0.936	transcription regulator activity
GO:0003700	0.926	DNA-binding transcription factor activity
GO:0000976	0.506	transcription cis-regulatory region binding
GO:0000981	0.503	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.408	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0032501	0.993	multicellular organismal process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0007399	0.979	nervous system development
GO:0030154	0.946	cell differentiation
GO:0031323	0.931	regulation of cellular metabolic process
GO:0080090	0.898	regulation of primary metabolic process
GO:0048699	0.789	generation of neurons
GO:0010468	0.754	regulation of gene expression
GO:0051171	0.719	regulation of nitrogen compound metabolic process
GO:0009889	0.676	regulation of biosynthetic process
GO:0030182	0.672	neuron differentiation
GO:0010556	0.670	regulation of macromolecule biosynthetic process
GO:0031326	0.669	regulation of cellular biosynthetic process
GO:0048518	0.634	positive regulation of biological process
GO:0048513	0.616	animal organ development
GO:1903506	0.507	regulation of nucleic acid-templated transcription
GO:0009653	0.503	anatomical structure morphogenesis
GO:0006355	0.503	regulation of DNA-templated transcription
GO:0050896	0.493	response to stimulus
GO:0048522	0.466	positive regulation of cellular process
GO:0048519	0.446	negative regulation of biological process
GO:0048523	0.442	negative regulation of cellular process
GO:0009893	0.436	positive regulation of metabolic process
GO:0010604	0.431	positive regulation of macromolecule metabolic process
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0006357	0.374	regulation of transcription by RNA polymerase II
GO:0031328	0.352	positive regulation of cellular biosynthetic process
GO:0045893	0.317	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0016020	0.928	membrane
GO:0005737	0.603	cytoplasm
GO:0005730	0.434	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]