StarFunc result for job id P19623

User Input

>input (302 residues)
MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYG
NVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESV
VQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGP
AESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPT
YPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND
VS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19623	1.000	1.000	2.841E-71	302	1.000	1.000	P19623.pdb.gz	SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1
2	PDB:2o06A	0.956	0.972	9.374E-63	297	0.983	1.000	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
3	AFDB:F1R3G8	0.941	0.983	2.083E-59	289	0.755	0.789	F1R3G8.pdb.gz	F1R3G8_DANRE Spermidine synthase OS=Danio rerio OX=7955 GN=fa18b03 PE=1 SV=1
4	AFDB:G5EAU1	0.939	0.971	3.955E-53	292	0.586	0.606	G5EAU1.pdb.gz	G5EAU1_EMENI SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase) (SPDSY)Spermidine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00687 PE=3 SV=1
5	AFDB:Q09741	0.944	0.957	1.069E-49	298	0.540	0.547	Q09741.pdb.gz	SPEE_SCHPO Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1
6	AFDB:Q12074	0.937	0.966	2.521E-49	293	0.550	0.567	Q12074.pdb.gz	SPEE_YEAST Spermidine synthase SPE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE3 PE=1 SV=1
7	AFDB:Q6FWB8	0.939	0.968	2.680E-49	293	0.550	0.567	Q6FWB8.pdb.gz	Q6FWB8_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SPE3 PE=3 SV=1
8	AFDB:Q9XY92	0.917	0.975	1.239E-48	284	0.550	0.585	Q9XY92.pdb.gz	SPEE_DICDI Spermidine synthase OS=Dictyostelium discoideum OX=44689 GN=spsA PE=3 SV=2
9	AFDB:O48661	0.931	0.829	6.814E-46	340	0.493	0.438	O48661.pdb.gz	SPDS2_ARATH Spermidine synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN2 PE=1 SV=2
10	AFDB:Q9ZUB3	0.925	0.838	4.026E-45	334	0.497	0.449	Q9ZUB3.pdb.gz	SPDS1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN1 PE=1 SV=1
11	AFDB:Q8II73	0.908	0.855	1.322E-43	321	0.421	0.396	Q8II73.pdb.gz	Q8II73_PLAF7 Spermidine synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1129000 PE=1 SV=1
12	PDB:6o65B	0.886	0.910	3.567E-43	294	0.490	0.503	6o65B.pdb.gz	Spermidine Synthase (SPDS) Undergoes Concerted Structural Rearrangements Upon Ligand Binding - A Case Study of the Two SPDS Isoforms FromArabidopsis thaliana.
13	PDB:2pt6A	0.900	0.966	7.629E-42	281	0.421	0.452	2pt6A.pdb.gz	Crystal structure of Plasmodium falciparum spermidine synthase in complex with the substrate decarboxylated S-adenosylmethionine and the potent inhibitors 4MCHA and AdoDATO.
14	PDB:1jq3A	0.855	0.874	1.163E-34	295	0.348	0.356	1jq3A.pdb.gz	The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
15	PDB:1mjfA	0.794	0.882	1.240E-29	271	0.301	0.336	1mjfA.pdb.gz
16	PDB:3o4fC	0.800	0.849	9.365E-29	284	0.325	0.345	3o4fC.pdb.gz
17	PDB:3anxB	0.821	0.793	1.372E-25	313	0.281	0.272	3anxB.pdb.gz	Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus
18	PDB:3c6kD	0.652	0.572	3.413E-18	348	0.195	0.170	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
19	PDB:2cmgA	0.764	0.872	2.424E-17	262	0.175	0.202	2cmgA.pdb.gz
20	PDB:3v97A	0.405	0.207	1.495E-7	667	0.070	0.031	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R3G8	0.0	503	289	0.755	0.789	F1R3G8_DANRE Spermidine synthase OS=Danio rerio OX=7955 GN=fa18b03 PE=1 SV=1
2	M0RCX8	0.0	599	321	0.937	0.882	M0RCX8_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
3	P19623	0.0	631	302	1.000	1.000	SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1
4	Q64674	0.0	605	302	0.947	0.947	SPEE_MOUSE Spermidine synthase OS=Mus musculus OX=10090 GN=Srm PE=1 SV=1
5	Q99MI5	0.0	609	302	0.954	0.954	Q99MI5_RAT Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1
6	Q7SY20	3.09e-180	500	289	0.748	0.782	Q7SY20_DANRE Zgc:63600 OS=Danio rerio OX=7955 GN=zgc:63600 PE=2 SV=1
7	G5EAU1	1.04e-138	395	292	0.583	0.603	G5EAU1_EMENI SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase) (SPDSY)Spermidine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00687 PE=3 SV=1
8	Q12074	4.65e-131	376	293	0.546	0.563	SPEE_YEAST Spermidine synthase SPE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE3 PE=1 SV=1
9	Q6FWB8	1.77e-129	372	293	0.546	0.563	Q6FWB8_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SPE3 PE=3 SV=1
10	Q09741	4.62e-125	361	298	0.533	0.540	SPEE_SCHPO Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1
11	Q9XY92	3.19e-118	343	284	0.560	0.595	SPEE_DICDI Spermidine synthase OS=Dictyostelium discoideum OX=44689 GN=spsA PE=3 SV=2
12	Q9ZUB3	4.02e-109	322	334	0.490	0.443	SPDS1_ARATH Spermidine synthase 1 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN1 PE=1 SV=1
13	O48661	5.67e-106	314	340	0.483	0.429	SPDS2_ARATH Spermidine synthase 2 OS=Arabidopsis thaliana OX=3702 GN=SPDSYN2 PE=1 SV=2
14	Q12455	1.57e-98	293	300	0.464	0.467	SPSY_YEAST Spermine synthase SPE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE4 PE=1 SV=1
15	A0A1U7VVY4	4.41e-93	282	381	0.470	0.373	A0A1U7VVY4_NICSY Putrescine N-methyltransferase 3 OS=Nicotiana sylvestris OX=4096 GN=LOC104222428 PE=3 SV=1
16	Q9SEH5	4.41e-93	282	381	0.470	0.373	PMT3_TOBAC Putrescine N-methyltransferase 3 OS=Nicotiana tabacum OX=4097 GN=PMT3 PE=2 SV=1
17	Q9ZWT9	5.14e-93	281	353	0.467	0.399	Q9ZWT9_NICSY Putrescine N-methyltransferase OS=Nicotiana sylvestris OX=4096 GN=NsPMT1 PE=3 SV=1
18	Q9SEH7	5.60e-93	281	353	0.467	0.399	PMT2_TOBAC Putrescine N-methyltransferase 2 OS=Nicotiana tabacum OX=4097 GN=PMT2 PE=2 SV=1
19	Q93XQ4	7.98e-93	281	371	0.470	0.383	PMT2_NICAT Putrescine N-methyltransferase 2 OS=Nicotiana attenuata OX=49451 GN=PMT2 PE=2 SV=1
20	Q42963	8.37e-93	281	375	0.470	0.379	PMT1_TOBAC Putrescine N-methyltransferase 1 OS=Nicotiana tabacum OX=4097 GN=PMT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13649 Methyltransf_25	4	19.5	Methyltransferase domain
2	PF05430 Methyltransf_30	5.5e+02	11.9	S-adenosyl-L-methionine-dependent methyltransferase
3	PF13847 Methyltransf_31	0.0087	27.3	Methyltransferase domain
4	PF01564 Spermine_synth	1.4e-70	248.1	Spermine/spermidine synthase domain
5	PF17284 Spermine_synt_N	2.5e-21	86.6	Spermidine synthase tetramerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000017219

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000011624	0.996	Adenosylmethionine decarboxylase 1
2	60711.ENSCSAP00000005938	0.995	Catalyzes the reversible phosphorylation of S-methyl-5'- thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates
3	60711.ENSCSAP00000003486	0.993	Belongs to the Orn/Lys/Arg decarboxylase class-II family.
4	60711.ENSCSAP00000010563	0.993	Spermine synthase
5	60711.ENSCSAP00000017171	0.981	Agmatinase
6	60711.ENSCSAP00000016944	0.959	Antizyme inhibitor 2
7	60711.ENSCSAP00000010526	0.954	Spermidine/spermine N1-acetyltransferase 1
8	60711.ENSCSAP00000007570	0.941	Spermidine/spermine N1-acetyltransferase family member 2
9	60711.ENSCSAP00000018954	0.938	Belongs to the Orn/Lys/Arg decarboxylase class-II family.
10	60711.ENSCSAP00000003129	0.934	Amine oxidase, copper containing 1
11	60711.ENSCSAP00000008122	0.923	Antizyme inhibitor 1
12	60711.ENSCSAP00000008734	0.910	Ornithine decarboxylase antizyme 2
13	60711.ENSCSAP00000007808	0.902	Uncharacterized protein
14	60711.ENSCSAP00000016872	0.902	annotation not available
15	60711.ENSCSAP00000009459	0.847	Arginase 2
16	60711.ENSCSAP00000012698	0.822	Arginase 1
17	60711.ENSCSAP00000006813	0.816	Aminoadipate-semialdehyde synthase
18	60711.ENSCSAP00000002338	0.788	Nitrilase family, member 2
19	60711.ENSCSAP00000002912	0.742	Polyamine oxidase (exo-N4-amino)
20	60711.ENSCSAP00000017214	0.673	UbiA prenyltransferase domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016765	1.000	transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0004766	0.987	spermidine synthase activity
GO:0005515	0.967	protein binding
GO:0042802	0.760	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0009058	0.980	biosynthetic process
GO:1901576	0.971	organic substance biosynthetic process
GO:0044249	0.967	cellular biosynthetic process
GO:0008216	0.963	spermidine metabolic process
GO:0034641	0.957	cellular nitrogen compound metabolic process
GO:1901566	0.952	organonitrogen compound biosynthetic process
GO:0044271	0.948	cellular nitrogen compound biosynthetic process
GO:0042401	0.908	biogenic amine biosynthetic process
GO:0006596	0.894	polyamine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.945	intracellular organelle lumen
GO:0043227	0.917	membrane-bounded organelle
GO:0043231	0.900	intracellular membrane-bounded organelle
GO:0005634	0.574	nucleus
GO:0005654	0.538	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.
RHEA:12721	0.987	putrescine + S-adenosyl 3-(methylsulfanyl)propylamine = H(+) + S-methyl-5'-thioadenosine + spermidine
EC:2.5.1.16	0.987	spermidine synthase.

[back to server]