StarFunc result for job id P19652

User Input

>input (201 residues)
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLL
FLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKK
DKCEPLEKQHEKERKQEEGES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02763	0.977	0.977	6.877E-36	201	0.896	0.896	P02763.pdb.gz	A1AG1_HUMAN Alpha-1-acid glycoprotein 1 OS=Homo sapiens OX=9606 GN=ORM1 PE=1 SV=2
2	PDB:3apxA	0.870	0.976	7.780E-34	179	0.876	0.983	3apxA.pdb.gz	Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
3	PDB:3kq0A	0.822	0.941	7.536E-30	175	0.761	0.874	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
4	AFDB:P02764	0.844	0.828	3.356E-21	205	0.423	0.415	P02764.pdb.gz	A1AG_RAT Alpha-1-acid glycoprotein OS=Rattus norvegicus OX=10116 GN=Orm1 PE=2 SV=1
5	AFDB:P02760	0.587	0.352	2.233E-10	352	0.154	0.088	P02760.pdb.gz	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
6	AFDB:Q64240	0.599	0.361	2.638E-10	349	0.159	0.092	Q64240.pdb.gz	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
7	AFDB:O97921	0.637	0.658	1.185E-9	194	0.159	0.165	O97921.pdb.gz	PTGDS_HORSE Prostaglandin-H2 D-isomerase OS=Equus caballus OX=9796 GN=PTGDS PE=1 SV=1
8	AFDB:Q07456	0.616	0.373	1.185E-9	349	0.124	0.072	Q07456.pdb.gz	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
9	AFDB:P41222	0.611	0.642	5.032E-9	190	0.144	0.153	P41222.pdb.gz	PTGDS_HUMAN Prostaglandin-H2 D-isomerase OS=Homo sapiens OX=9606 GN=PTGDS PE=1 SV=1
10	AFDB:Q6UWW0	0.597	0.646	5.624E-9	184	0.114	0.125	Q6UWW0.pdb.gz	LCN15_HUMAN Lipocalin-15 OS=Homo sapiens OX=9606 GN=LCN15 PE=1 SV=1
11	AFDB:P14630	0.566	0.596	1.370E-8	190	0.129	0.137	P14630.pdb.gz	APOM_RAT Apolipoprotein M OS=Rattus norvegicus OX=10116 GN=Apom PE=1 SV=2
12	PDB:2qosC	0.602	0.688	1.913E-8	173	0.090	0.104	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
13	AFDB:O02853	0.647	0.677	4.657E-8	191	0.154	0.162	O02853.pdb.gz	PTGDS_BOVIN Prostaglandin-H2 D-isomerase OS=Bos taurus OX=9913 GN=PTGDS PE=1 SV=1
14	PDB:5n47A	0.562	0.620	5.504E-8	180	0.104	0.117	5n47A.pdb.gz
15	PDB:6s8vA	0.542	0.622	6.503E-8	172	0.104	0.122	6s8vA.pdb.gz
16	PDB:4qaeB	0.534	0.602	6.875E-8	175	0.095	0.109	4qaeB.pdb.gz	Structure of a hepcidin-binding anticalin in complex with its peptide ligand
17	PDB:4gh7A	0.545	0.618	1.015E-7	174	0.090	0.103	4gh7A.pdb.gz
18	PDB:3saoA	0.534	0.693	1.073E-7	150	0.080	0.107	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
19	PDB:6z2cA	0.518	0.575	1.199E-7	178	0.129	0.146	6z2cA.pdb.gz	Structure of an engineered lipocalin that catalyzes a Diels-Alder reaction
20	PDB:3s26A	0.545	0.635	1.417E-7	169	0.080	0.095	3s26A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19652	3.06e-152	421	201	1.000	1.000	A1AG2_HUMAN Alpha-1-acid glycoprotein 2 OS=Homo sapiens OX=9606 GN=ORM2 PE=1 SV=2
2	P02763	1.57e-127	359	201	0.900	0.900	A1AG1_HUMAN Alpha-1-acid glycoprotein 1 OS=Homo sapiens OX=9606 GN=ORM1 PE=1 SV=2
3	P02764	3.50e-47	155	205	0.398	0.390	A1AG_RAT Alpha-1-acid glycoprotein OS=Rattus norvegicus OX=10116 GN=Orm1 PE=2 SV=1
4	O16519	0.28	34.3	620	0.124	0.040	GAD1_CAEEL Gastrulation defective protein 1 OS=Caenorhabditis elegans OX=6239 GN=gad-1 PE=1 SV=1
5	Q46925	3.1	30.8	401	0.100	0.050	CSDA_ECOLI Cysteine desulfurase CsdA OS=Escherichia coli (strain K12) OX=83333 GN=csdA PE=1 SV=1
6	Q9M088	3.4	30.8	484	0.114	0.048	E135_ARATH Glucan endo-1,3-beta-glucosidase 5 OS=Arabidopsis thaliana OX=3702 GN=At4g31140 PE=2 SV=1
7	Q504Y0	3.9	30.8	691	0.169	0.049	S39AC_HUMAN Zinc transporter ZIP12 OS=Homo sapiens OX=9606 GN=SLC39A12 PE=2 SV=3
8	Q9BP41	6.2	30.0	1241	0.070	0.011	Q9BP41_DROME RanBP21 OS=Drosophila melanogaster OX=7227 GN=Ranbp21 PE=1 SV=1
9	Q5T1C6	8.2	29.3	240	0.070	0.058	THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1
10	Q5T1H1	8.6	29.6	3165	0.100	0.006	EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens OX=9606 GN=EYS PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	3.2e-14	64.8	Lipocalin / cytosolic fatty-acid binding protein family
2	PF13306 LRR_5	15	17.0	BspA type Leucine rich repeat region (6 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259396	0.984	Alpha-1-acid glycoprotein 1
2	9606.ENSP00000243045	0.931	ORM1-like protein 2
3	9606.ENSP00000326869	0.908	ORM1-like protein 1
4	9606.ENSP00000393887	0.896	Alpha-2-HS-glycoprotein
5	9606.ENSP00000356969	0.854	Apolipoprotein A-II
6	9606.ENSP00000377724	0.849	ORM1-like protein 3
7	9606.ENSP00000295897	0.848	Serum albumin
8	9606.ENSP00000265132	0.846	Protein AMBP
9	9606.ENSP00000236850	0.830	Apolipoprotein A-I
10	9606.ENSP00000227667	0.804	Apolipoprotein C-III
11	9606.ENSP00000205948	0.784	Beta-2-glycoprotein 1
12	9606.ENSP00000237014	0.770	Transthyretin
13	9606.ENSP00000348170	0.764	Haptoglobin
14	9606.ENSP00000416066	0.752	Alpha-1-antitrypsin
15	9606.ENSP00000415769	0.743	Inter-alpha-trypsin inhibitor heavy chain H3
16	9606.ENSP00000356671	0.740	Antithrombin-III
17	9606.ENSP00000306361	0.723	Fibrinogen alpha chain
18	9606.ENSP00000336829	0.711	Fibrinogen gamma chain
19	9606.ENSP00000421725	0.709	Vitamin D-binding protein
20	9606.ENSP00000351190	0.696	Inter-alpha-trypsin inhibitor heavy chain H2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0001819	0.996	positive regulation of cytokine production
GO:0032652	0.994	regulation of interleukin-1 production
GO:1903555	0.992	regulation of tumor necrosis factor superfamily cytokine production
GO:0032651	0.960	regulation of interleukin-1 beta production
GO:1903557	0.946	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0032732	0.946	positive regulation of interleukin-1 production
GO:0032760	0.936	positive regulation of tumor necrosis factor production
GO:0032731	0.934	positive regulation of interleukin-1 beta production
GO:0006950	0.895	response to stress
GO:0002526	0.857	acute inflammatory response
GO:0009987	0.671	cellular process
GO:0048519	0.619	negative regulation of biological process
GO:0050794	0.528	regulation of cellular process
GO:0006953	0.457	acute-phase response
GO:0051241	0.392	negative regulation of multicellular organismal process
GO:0071704	0.337	organic substance metabolic process
GO:0032501	0.329	multicellular organismal process
GO:0009892	0.306	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0071944	0.997	cell periphery
GO:0070062	0.994	extracellular exosome
GO:0072562	0.992	blood microparticle
GO:0062023	0.991	collagen-containing extracellular matrix
GO:0034774	0.991	secretory granule lumen
GO:0031093	0.977	platelet alpha granule lumen
GO:0042581	0.953	specific granule
GO:0035580	0.904	specific granule lumen
GO:0005773	0.496	vacuole
GO:0016020	0.492	membrane
GO:0000323	0.471	lytic vacuole
GO:0005788	0.462	endoplasmic reticulum lumen
GO:0005764	0.443	lysosome
GO:0005886	0.438	plasma membrane
GO:0032991	0.412	protein-containing complex
GO:0005775	0.364	vacuolar lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]