StarFunc result for job id P19793

User Input

>input (462 residues)
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51128	0.812	0.770	2.170E-52	488	0.900	0.852	P51128.pdb.gz	RXRA_XENLA Retinoic acid receptor RXR-alpha OS=Xenopus laevis OX=8355 GN=rxra PE=1 SV=1
2	AFDB:P51129	0.770	0.757	4.915E-44	470	0.690	0.679	P51129.pdb.gz	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
3	AFDB:Q90417	0.670	0.732	4.675E-42	422	0.652	0.713	Q90417.pdb.gz	RXRBB_DANRE Retinoic acid receptor RXR-beta-B OS=Danio rerio OX=7955 GN=rxrbb PE=2 SV=1
4	PDB:3dzyA	0.641	0.976	3.031E-35	302	0.654	1.000	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
5	AFDB:P20153	0.617	0.564	9.957E-28	508	0.439	0.400	P20153.pdb.gz	USP_DROME Protein ultraspiracle OS=Drosophila melanogaster OX=7227 GN=usp PE=1 SV=1
6	AFDB:P49866	0.456	0.305	7.571E-25	704	0.353	0.232	P49866.pdb.gz	HNF4_DROME Transcription factor HNF-4 homolog OS=Drosophila melanogaster OX=7227 GN=Hnf4 PE=1 SV=3
7	AFDB:Q6PHH5	0.442	0.441	2.974E-23	463	0.333	0.333	Q6PHH5.pdb.gz
8	AFDB:A0A6E1WB48	0.448	0.455	5.056E-23	455	0.314	0.319	A0A6E1WB48.pdb.gz	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
9	AFDB:F1D8T1	0.452	0.441	1.461E-22	474	0.325	0.316	F1D8T1.pdb.gz	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
10	AFDB:F1NZ15	0.442	0.438	1.461E-22	466	0.325	0.322	F1NZ15.pdb.gz	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
11	AFDB:F1D8R0	0.385	0.424	2.274E-22	414	0.320	0.357	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
12	PDB:1g2nA	0.383	0.703	4.054E-13	246	0.208	0.390	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.440	0.820	3.091E-11	238	0.145	0.282	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.377	0.651	1.710E-5	259	0.091	0.162	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4q25A	0.145	0.238	6.660E-1	211	0.063	0.137	4q25A.pdb.gz
16	PDB:7b93H	0.120	0.154	7.948E-1	318	0.056	0.082	7b93H.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:1ggqA	0.073	0.155	8.683E-1	162	0.041	0.117	1ggqA.pdb.gz
18	PDB:7qskH	0.115	0.148	9.076E-1	318	0.067	0.097	7qskH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:1qoyA	0.070	0.099	9.486E-1	303	0.082	0.125	1qoyA.pdb.gz
20	PDB:4p9uE	0.090	0.127	1.083	272	0.095	0.162	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4M5	526	508	0.608	0.553	A0A0S2Z4M5_HUMAN Retinoid X receptor beta isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=1
2	A0A0S2Z570	582	537	0.658	0.566	A0A0S2Z570_HUMAN RXRB (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
3	A0A1D5P2B5	923	467	0.965	0.955	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
4	P19793	960	462	1.000	1.000	RXRA_HUMAN Retinoic acid receptor RXR-alpha OS=Homo sapiens OX=9606 GN=RXRA PE=1 SV=1
5	P28700	937	467	0.985	0.974	RXRA_MOUSE Retinoic acid receptor RXR-alpha OS=Mus musculus OX=10090 GN=Rxra PE=1 SV=1
6	P28701	668	467	0.703	0.696	RXRG_CHICK Retinoic acid receptor RXR-gamma OS=Gallus gallus OX=9031 GN=RXRG PE=2 SV=1
7	P28702	587	533	0.658	0.570	RXRB_HUMAN Retinoic acid receptor RXR-beta OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=2
8	P28704	581	520	0.649	0.577	RXRB_MOUSE Retinoic acid receptor RXR-beta OS=Mus musculus OX=10090 GN=Rxrb PE=1 SV=2
9	P28705	656	463	0.701	0.700	RXRG_MOUSE Retinoic acid receptor RXR-gamma OS=Mus musculus OX=10090 GN=Rxrg PE=2 SV=2
10	P48443	657	463	0.708	0.706	RXRG_HUMAN Retinoic acid receptor RXR-gamma OS=Homo sapiens OX=9606 GN=RXRG PE=1 SV=1
11	P49743	584	458	0.652	0.657	RXRB_RAT Retinoic acid receptor RXR-beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Rxrb PE=1 SV=1
12	P51128	815	488	0.887	0.840	RXRA_XENLA Retinoic acid receptor RXR-alpha OS=Xenopus laevis OX=8355 GN=rxra PE=1 SV=1
13	P51129	653	470	0.706	0.694	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
14	Q05343	938	467	0.985	0.974	RXRA_RAT Retinoic acid receptor RXR-alpha OS=Rattus norvegicus OX=10116 GN=Rxra PE=1 SV=1
15	Q5BJR8	653	463	0.699	0.698	RXRG_RAT Retinoic acid receptor RXR-gamma OS=Rattus norvegicus OX=10116 GN=Rxrg PE=1 SV=1
16	Q5STP9	587	533	0.658	0.570	Q5STP9_HUMAN Retinoid X nuclear receptor beta OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
17	Q7SYN5	654	471	0.723	0.709	RXRBA_DANRE Retinoic acid receptor RXR-beta-A OS=Danio rerio OX=7955 GN=rxrba PE=2 SV=1
18	Q90415	707	379	0.732	0.892	RXRAB_DANRE Retinoic acid receptor RXR-alpha-B OS=Danio rerio OX=7955 GN=rxrab PE=2 SV=1
19	Q90416	684	441	0.719	0.753	RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio OX=7955 GN=rxrga PE=2 SV=2
20	Q90417	598	422	0.652	0.713	RXRBB_DANRE Retinoic acid receptor RXR-beta-B OS=Danio rerio OX=7955 GN=rxrbb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	9.7e-34	128.4	Ligand-binding domain of nuclear hormone receptor
2	PF11825 Nuc_recep-AF1	4.9e-35	131.3	Nuclear/hormone receptor activator site AF-1
3	PF00105 zf-C4	1.4e-28	110.4	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419692

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
2	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
3	9606.ENSP00000254066	0.998	Retinoic acid receptor alpha
4	9606.ENSP00000287820	0.998	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000384018	0.998	Nuclear receptor corepressor 2
6	9606.ENSP00000447173	0.998	Vitamin D3 receptor
7	9606.ENSP00000477707	0.998	Oxysterols receptor LXR-alpha
8	9606.ENSP00000332296	0.996	Retinoic acid receptor beta
9	9606.ENSP00000379904	0.996	Thyroid hormone receptor beta
10	9606.ENSP00000300651	0.994	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000253727	0.993	Oxysterols receptor LXR-beta
12	9606.ENSP00000447149	0.992	Bile acid receptor
13	9606.ENSP00000385523	0.991	Peroxisome proliferator-activated receptor alpha
14	9606.ENSP00000361066	0.988	Nuclear receptor coactivator 3
15	9606.ENSP00000264867	0.987	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
16	9606.ENSP00000262367	0.986	CREB-binding protein
17	9606.ENSP00000336528	0.984	Nuclear receptor subfamily 1 group I member 2
18	9606.ENSP00000264637	0.980	Thyroid hormone receptor alpha
19	9606.ENSP00000440864	0.976	Nuclear receptor subfamily 4 group A member 1
20	9606.ENSP00000310928	0.975	Peroxisome proliferator-activated receptor delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	0.998	DNA binding
GO:0016922	0.998	nuclear receptor binding
GO:0004879	0.995	nuclear receptor activity
GO:0043565	0.984	sequence-specific DNA binding
GO:0003690	0.982	double-stranded DNA binding
GO:1990837	0.952	sequence-specific double-stranded DNA binding
GO:0001067	0.938	transcription regulatory region nucleic acid binding
GO:0000976	0.880	transcription cis-regulatory region binding
GO:0046982	0.493	protein heterodimerization activity
GO:0000987	0.371	cis-regulatory region sequence-specific DNA binding
GO:0046966	0.363	nuclear thyroid hormone receptor binding
GO:0000977	0.331	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0009987	0.987	cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0048518	0.986	positive regulation of biological process
GO:0009889	0.986	regulation of biosynthetic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.977	regulation of cellular biosynthetic process
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0051252	0.966	regulation of RNA metabolic process
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0050896	0.954	response to stimulus
GO:0048522	0.938	positive regulation of cellular process
GO:0006357	0.899	regulation of transcription by RNA polymerase II
GO:0010604	0.898	positive regulation of macromolecule metabolic process
GO:0008152	0.858	metabolic process
GO:0071704	0.833	organic substance metabolic process
GO:0045893	0.817	positive regulation of DNA-templated transcription
GO:0044238	0.788	primary metabolic process
GO:0044237	0.602	cellular metabolic process
GO:0032502	0.561	developmental process
GO:0006807	0.545	nitrogen compound metabolic process
GO:0032501	0.508	multicellular organismal process
GO:0048856	0.500	anatomical structure development
GO:0048519	0.482	negative regulation of biological process
GO:0051716	0.481	cellular response to stimulus
GO:0043170	0.471	macromolecule metabolic process
GO:0048523	0.444	negative regulation of cellular process
GO:0042221	0.403	response to chemical
GO:1901360	0.381	organic cyclic compound metabolic process
GO:0009892	0.370	negative regulation of metabolic process
GO:0007154	0.366	cell communication
GO:0045944	0.359	positive regulation of transcription by RNA polymerase II
GO:0051172	0.338	negative regulation of nitrogen compound metabolic process
GO:0031324	0.338	negative regulation of cellular metabolic process
GO:0010558	0.322	negative regulation of macromolecule biosynthetic process
GO:0031327	0.322	negative regulation of cellular biosynthetic process
GO:0023052	0.309	signaling
GO:0045934	0.307	negative regulation of nucleobase-containing compound metabolic process
GO:0048583	0.302	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.996	protein-containing complex
GO:0005654	0.995	nucleoplasm
GO:0005667	0.986	transcription regulator complex
GO:0140513	0.780	nuclear protein-containing complex
GO:0005737	0.640	cytoplasm
GO:0090575	0.331	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]