StarFunc result for job id P19838

User Input

>input (968 residues)
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19838	1.000	1.000	0.000	968	1.000	1.000	P19838.pdb.gz	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
2	AFDB:P25799	0.401	0.400	0.000	971	0.869	0.866	P25799.pdb.gz	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
3	AFDB:Q04861	0.396	0.390	0.000	983	0.723	0.712	Q04861.pdb.gz	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
4	AFDB:Q00653	0.347	0.371	1.506E-81	900	0.417	0.449	Q00653.pdb.gz	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
5	AFDB:Q0II00	0.351	0.375	2.713E-81	902	0.417	0.448	Q0II00.pdb.gz	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
6	AFDB:A0A2R8RJY5	0.337	0.374	1.453E-75	863	0.388	0.436	A0A2R8RJY5.pdb.gz
7	AFDB:Q6DGE6	0.290	0.466	9.238E-36	596	0.173	0.280	Q6DGE6.pdb.gz	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
8	AFDB:Q04864	0.285	0.441	2.126E-35	619	0.173	0.270	Q04864.pdb.gz	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
9	AFDB:P16236	0.286	0.458	2.463E-35	598	0.174	0.281	P16236.pdb.gz	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
10	AFDB:P15307	0.287	0.467	5.669E-35	587	0.174	0.286	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
11	PDB:8cs9A	0.229	0.277	4.949E-13	796	0.090	0.109	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.196	0.266	1.613E-10	692	0.089	0.124	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:2dvwA	0.201	0.807	9.898E-10	229	0.059	0.249	2dvwA.pdb.gz
14	PDB:1wg0A	0.198	0.699	5.243E-9	243	0.058	0.230	1wg0A.pdb.gz
15	PDB:5vkqA	0.148	0.108	5.243E-9	1499	0.102	0.066	5vkqA.pdb.gz
16	PDB:6v9hC	0.213	0.716	1.620E-8	270	0.067	0.241	6v9hC.pdb.gz
17	PDB:6aunA	0.215	0.328	1.209E-7	618	0.063	0.099	6aunA.pdb.gz
18	PDB:6pqpA	0.178	0.276	7.423E-7	615	0.049	0.076	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.159	0.742	1.273E-6	192	0.042	0.214	6jd6B.pdb.gz
20	PDB:6v9xA	0.189	0.308	2.293E-6	571	0.066	0.112	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19838	0.0	1996	968	1.000	1.000	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
2	P25799	0.0	1636	971	0.873	0.870	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
3	Q00653	0.0	562	900	0.394	0.423	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
4	Q04861	0.0	1332	983	0.725	0.714	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
5	Q63369	0.0	838	522	0.441	0.818	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2
6	Q0II00	9.30e-126	405	902	0.205	0.220	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
7	Q9WTK5	3.97e-125	403	899	0.202	0.218	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
8	A0A8I6G6F3	2.69e-116	380	902	0.195	0.210	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
9	Q6DGE6	1.52e-81	278	596	0.152	0.247	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
10	P16236	8.10e-78	268	598	0.145	0.234	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
11	F1M5R1	9.18e-76	261	566	0.152	0.260	F1M5R1_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=3
12	A0A8I5XW27	2.06e-75	261	585	0.150	0.248	A0A8I5XW27_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
13	A0A8I6ABJ7	2.40e-75	261	595	0.152	0.247	A0A8I6ABJ7_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
14	Q04864	6.02e-75	260	619	0.153	0.239	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
15	P15307	1.01e-74	259	587	0.152	0.250	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
16	Q20KN1	4.58e-72	251	562	0.150	0.258	Q20KN1_CARRO NFkB OS=Carcinoscorpius rotundicauda OX=6848 GN=NFkB PE=1 SV=1
17	Q2TAM5	7.32e-70	239	377	0.136	0.350	Q2TAM5_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
18	A0A087X0W8	1.43e-69	241	448	0.136	0.295	A0A087X0W8_HUMAN RELA proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
19	F7F7J5	1.61e-69	243	541	0.136	0.244	F7F7J5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
20	Q7TQN4	2.79e-69	243	550	0.136	0.240	Q7TQN4_RAT Nuclear factor kappaB subunit p65 OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.9e-18	77.2	Ankyrin repeat
2	PF12796 Ank_2	4.2e-22	89.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.8e-15	66.4	Ankyrin repeat
4	PF13637 Ank_4	6.3e-21	85.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.2e-11	55.0	Ankyrin repeats (many copies)
6	PF00531 Death	5.1e-07	41.1	Death domain
7	PF16179 RHD_dimer	4.3e-36	134.4	Rel homology dimerisation domain
8	PF00554 RHD_DNA_bind	2.6e-69	244.0	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000221452	0.999	Transcription factor RelB
3	9606.ENSP00000359424	0.999	Inhibitor of nuclear factor kappa-B kinase subunit alpha
4	9606.ENSP00000384273	0.999	Transcription factor p65
5	9606.ENSP00000430684	0.999	Inhibitor of nuclear factor kappa-B kinase subunit beta
6	9606.ENSP00000263056	0.997	Mitogen-activated protein kinase kinase kinase 8
7	9606.ENSP00000321203	0.996	TNFAIP3-interacting protein 2
8	9606.ENSP00000362649	0.996	Histone deacetylase 1
9	9606.ENSP00000295025	0.993	Proto-oncogene c-Rel
10	9606.ENSP00000263253	0.992	Histone acetyltransferase p300
11	9606.ENSP00000359206	0.992	F-box/WD repeat-containing protein 1A
12	9606.ENSP00000312988	0.991	NF-kappa-B inhibitor beta
13	9606.ENSP00000164227	0.990	B-cell lymphoma 3 protein
14	9606.ENSP00000483825	0.982	NF-kappa-B essential modulator
15	9606.ENSP00000231509	0.978	Glucocorticoid receptor
16	9606.ENSP00000302967	0.976	Histone deacetylase 3
17	9606.ENSP00000358983	0.975	Nuclear factor NF-kappa-B p100 subunit
18	9606.ENSP00000401399	0.973	Myeloid differentiation primary response protein MyD88
19	9606.ENSP00000398698	0.970	Tumor necrosis factor
20	9606.ENSP00000262367	0.969	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	1.000	transcription regulator activity
GO:0042802	1.000	identical protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.992	transcription factor binding
GO:0019899	0.988	enzyme binding
GO:0001228	0.987	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001217	0.732	DNA-binding transcription repressor activity
GO:0001223	0.722	transcription coactivator binding
GO:0042805	0.721	actinin binding
GO:0001227	0.720	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.969	cellular response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0010468	0.968	regulation of gene expression
GO:0006355	0.956	regulation of DNA-templated transcription
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0048583	0.946	regulation of response to stimulus
GO:0007154	0.940	cell communication
GO:0008152	0.930	metabolic process
GO:0032502	0.925	developmental process
GO:0071345	0.925	cellular response to cytokine stimulus
GO:0048519	0.917	negative regulation of biological process
GO:0032501	0.907	multicellular organismal process
GO:0023052	0.904	signaling
GO:0048523	0.898	negative regulation of cellular process
GO:0006950	0.897	response to stress
GO:0071222	0.897	cellular response to lipopolysaccharide
GO:0045944	0.896	positive regulation of transcription by RNA polymerase II
GO:0023051	0.879	regulation of signaling
GO:0010646	0.879	regulation of cell communication
GO:0071704	0.865	organic substance metabolic process
GO:0048584	0.842	positive regulation of response to stimulus
GO:0002682	0.831	regulation of immune system process
GO:0048856	0.827	anatomical structure development
GO:0001817	0.809	regulation of cytokine production
GO:0034612	0.796	response to tumor necrosis factor
GO:0002376	0.780	immune system process
GO:0071356	0.765	cellular response to tumor necrosis factor
GO:0044238	0.753	primary metabolic process
GO:0000122	0.749	negative regulation of transcription by RNA polymerase II
GO:0010941	0.742	regulation of cell death
GO:0043170	0.735	macromolecule metabolic process
GO:0065009	0.722	regulation of molecular function
GO:0007275	0.715	multicellular organism development
GO:0007165	0.713	signal transduction
GO:0007166	0.686	cell surface receptor signaling pathway
GO:0010628	0.680	positive regulation of gene expression
GO:0048731	0.671	system development
GO:0044237	0.615	cellular metabolic process
GO:0080134	0.610	regulation of response to stress
GO:0006952	0.606	defense response
GO:0009966	0.606	regulation of signal transduction
GO:0010243	0.599	response to organonitrogen compound
GO:0071347	0.597	cellular response to interleukin-1
GO:0002684	0.581	positive regulation of immune system process
GO:0009719	0.578	response to endogenous stimulus
GO:0043067	0.568	regulation of programmed cell death
GO:0006807	0.566	nitrogen compound metabolic process
GO:0009967	0.487	positive regulation of signal transduction
GO:0009653	0.486	anatomical structure morphogenesis
GO:0014070	0.478	response to organic cyclic compound
GO:0051246	0.465	regulation of protein metabolic process
GO:0042981	0.451	regulation of apoptotic process
GO:0050776	0.440	regulation of immune response
GO:0050790	0.393	regulation of catalytic activity
GO:1902531	0.386	regulation of intracellular signal transduction
GO:0009628	0.378	response to abiotic stimulus
GO:0009725	0.369	response to hormone
GO:0002253	0.346	activation of immune response
GO:1901564	0.331	organonitrogen compound metabolic process
GO:0002757	0.327	immune response-activating signaling pathway
GO:0019538	0.323	protein metabolic process
GO:0009612	0.302	response to mechanical stimulus
GO:1901699	0.301	cellular response to nitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0005634	0.996	nucleus
GO:0032991	0.966	protein-containing complex
GO:0070013	0.942	intracellular organelle lumen
GO:0005654	0.902	nucleoplasm
GO:0140513	0.387	nuclear protein-containing complex
GO:0071159	0.383	NF-kappaB complex
GO:0033256	0.380	I-kappaB/NF-kappaB complex
GO:0034774	0.368	secretory granule lumen
GO:0005739	0.364	mitochondrion
GO:0035580	0.345	specific granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]