StarFunc result for job id P19883

User Input

>input (344 residues)
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19883	1.000	1.000	2.907E-73	344	1.000	1.000	P19883.pdb.gz	FST_HUMAN Follistatin OS=Homo sapiens OX=9606 GN=FST PE=1 SV=2
2	AFDB:Q90844	0.921	0.924	1.029E-66	343	0.892	0.895	Q90844.pdb.gz	FST_CHICK Follistatin OS=Gallus gallus OX=9031 GN=FST PE=2 SV=1
3	AFDB:Q9YHV4	0.881	0.940	1.002E-57	322	0.701	0.748	Q9YHV4.pdb.gz	FSTA_DANRE Follistatin-A OS=Danio rerio OX=7955 GN=fsta PE=2 SV=2
4	PDB:2p6aD	0.795	0.932	1.026E-47	292	0.846	0.997	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
5	AFDB:A0A024R1Y8	0.595	0.768	6.944E-29	263	0.299	0.392	A0A024R1Y8.pdb.gz
6	AFDB:Q99PW7	0.587	0.778	2.550E-28	256	0.297	0.398	Q99PW7.pdb.gz	FSTL3_RAT Follistatin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Fstl3 PE=2 SV=1
7	PDB:3b4vD	0.572	0.899	5.759E-28	213	0.299	0.484	3b4vD.pdb.gz
8	AFDB:Q86NV3	0.772	0.365	8.861E-27	767	0.363	0.163	Q86NV3.pdb.gz	Q86NV3_DROME Follistatin, isoform A OS=Drosophila melanogaster OX=7227 GN=Fs PE=2 SV=1
9	AFDB:G5EG68	0.197	0.082	9.788E-16	1473	0.244	0.057	G5EG68.pdb.gz	G5EG68_CAEEL AGRin (Synaptic protein) homolog family member OS=Caenorhabditis elegans OX=6239 GN=agr-1 PE=1 SV=1
10	AFDB:P31696	0.177	0.049	5.126E-15	2081	0.230	0.038	P31696.pdb.gz	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
11	AFDB:F1R074	0.214	0.056	1.486E-14	2026	0.259	0.044	F1R074.pdb.gz
12	AFDB:P25304	0.186	0.048	1.325E-13	1959	0.244	0.043	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
13	PDB:1yu6C	0.108	0.627	2.318E-2	51	0.041	0.275	1yu6C.pdb.gz	Structure of the subtilisin Carlsberg-OMTKY3 complex reveals two different ovomucoid conformations.
14	PDB:7qe9C	0.124	0.619	5.305E-2	60	0.041	0.233	7qe9C.pdb.gz
15	PDB:3t5oA	0.176	0.085	1.450E-1	871	0.140	0.055	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
16	PDB:2xrcC	0.153	0.123	2.468E-1	454	0.058	0.044	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
17	PDB:2leoA	0.125	0.539	2.619E-1	66	0.064	0.333	2leoA.pdb.gz
18	PDB:2xrcB	0.138	0.104	2.778E-1	485	0.047	0.033	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
19	PDB:1wfsA	0.077	0.142	1.020	151	0.041	0.093	1wfsA.pdb.gz
20	PDB:7jr9A	0.085	0.105	1.293	254	0.038	0.051	7jr9A.pdb.gz	Structure of the radial spoke head and insights into its role in mechanoregulation of ciliary beating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19883	0.0	701	344	1.000	1.000	FST_HUMAN Follistatin OS=Homo sapiens OX=9606 GN=FST PE=1 SV=2
2	P21674	0.0	683	344	0.977	0.977	FST_RAT Follistatin OS=Rattus norvegicus OX=10116 GN=Fst PE=1 SV=1
3	P47931	0.0	684	344	0.980	0.980	FST_MOUSE Follistatin OS=Mus musculus OX=10090 GN=Fst PE=2 SV=1
4	Q90844	0.0	587	343	0.895	0.898	FST_CHICK Follistatin OS=Gallus gallus OX=9031 GN=FST PE=2 SV=1
5	Q9YHV4	0.0	514	322	0.701	0.748	FSTA_DANRE Follistatin-A OS=Danio rerio OX=7955 GN=fsta PE=2 SV=2
6	O95633	6.42e-67	213	263	0.302	0.395	FSTL3_HUMAN Follistatin-related protein 3 OS=Homo sapiens OX=9606 GN=FSTL3 PE=1 SV=1
7	Q9EQC7	7.27e-64	205	256	0.294	0.395	FSTL3_MOUSE Follistatin-related protein 3 OS=Mus musculus OX=10090 GN=Fstl3 PE=1 SV=1
8	Q99PW7	4.46e-63	203	256	0.294	0.395	FSTL3_RAT Follistatin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Fstl3 PE=2 SV=1
9	Q86NV3	1.25e-32	130	767	0.235	0.106	Q86NV3_DROME Follistatin, isoform A OS=Drosophila melanogaster OX=7227 GN=Fs PE=2 SV=1
10	A2ASQ1	6.70e-25	108	1950	0.247	0.044	AGRIN_MOUSE Agrin OS=Mus musculus OX=10090 GN=Agrn PE=1 SV=1
11	P25304	1.49e-23	104	1959	0.244	0.043	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
12	G5EG68	4.06e-22	100	1473	0.224	0.052	G5EG68_CAEEL AGRin (Synaptic protein) homolog family member OS=Caenorhabditis elegans OX=6239 GN=agr-1 PE=1 SV=1
13	O00468	1.57e-21	98.2	2068	0.233	0.039	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
14	P31696	1.80e-20	95.1	2081	0.227	0.037	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
15	A0A0R4IJ40	2.94e-19	91.7	1926	0.206	0.037	A0A0R4IJ40_DANRE Agrin OS=Danio rerio OX=7955 GN=hm:gc12 PE=1 SV=1
16	B3GQ72	1.74e-18	89.4	2028	0.224	0.038	B3GQ72_DANRE Agrin OS=Danio rerio OX=7955 GN=wu:fb57e07 PE=1 SV=1
17	P10184	1.16e-11	67.8	517	0.189	0.126	IOV7_CHICK Ovoinhibitor OS=Gallus gallus OX=9031 GN=SPINK5 PE=1 SV=3
18	P01005	4.31e-11	63.9	210	0.157	0.257	IOVO_CHICK Ovomucoid OS=Gallus gallus OX=9031 PE=1 SV=1
19	Q12841	6.87e-10	61.6	308	0.102	0.114	FSTL1_HUMAN Follistatin-related protein 1 OS=Homo sapiens OX=9606 GN=FSTL1 PE=1 SV=1
20	Q62356	1.00e-09	61.2	306	0.102	0.114	FSTL1_MOUSE Follistatin-related protein 1 OS=Mus musculus OX=10090 GN=Fstl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09289 FOLN	0.0038	28.7	Follistatin/Osteonectin-like EGF domain
2	PF00050 Kazal_1	3.1e-16	70.4	Kazal-type serine protease inhibitor domain
3	PF07648 Kazal_2	2.4e-34	128.5	Kazal-type serine protease inhibitor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260950	0.998	Growth/differentiation factor 8
2	9606.ENSP00000242208	0.997	Inhibin beta A chain
3	9606.ENSP00000363708	0.982	Bone morphogenetic protein receptor type-2
4	9606.ENSP00000361107	0.980	Bone morphogenetic protein receptor type-1A
5	9606.ENSP00000245451	0.977	Bone morphogenetic protein 4
6	9606.ENSP00000368104	0.972	Bone morphogenetic protein 2
7	9606.ENSP00000379204	0.972	Bone morphogenetic protein 7
8	9606.ENSP00000364683	0.955	BMP and activin membrane-bound inhibitor homolog
9	9606.ENSP00000257868	0.952	Growth/differentiation factor 11
10	9606.ENSP00000295228	0.951	Inhibin beta B chain
11	9606.ENSP00000401907	0.945	Bone morphogenetic protein receptor type-1B
12	9606.ENSP00000266646	0.927	Inhibin beta E chain
13	9606.ENSP00000337014	0.912	Hemojuvelin
14	9606.ENSP00000308219	0.911	RGM domain family member B
15	9606.ENSP00000452126	0.910	Repulsive guidance molecule A
16	9606.ENSP00000204604	0.907	Chordin
17	9606.ENSP00000308716	0.874	Inhibin beta C chain
18	9606.ENSP00000336762	0.795	Angiogenin
19	9606.ENSP00000243786	0.792	Inhibin alpha chain
20	9606.ENSP00000241416	0.790	Activin receptor type-2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0048185	0.999	activin binding
GO:0098772	0.998	molecular function regulator activity
GO:0140678	0.992	molecular function inhibitor activity
GO:0005102	0.991	signaling receptor binding
GO:0030545	0.979	signaling receptor regulator activity
GO:0030547	0.919	signaling receptor inhibitor activity
GO:0038102	0.552	activin receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048856	0.991	anatomical structure development
GO:0051239	0.988	regulation of multicellular organismal process
GO:0048523	0.988	negative regulation of cellular process
GO:0032501	0.984	multicellular organismal process
GO:0009987	0.981	cellular process
GO:0050896	0.980	response to stimulus
GO:0050793	0.976	regulation of developmental process
GO:0023051	0.964	regulation of signaling
GO:0010646	0.953	regulation of cell communication
GO:0007275	0.925	multicellular organism development
GO:0070848	0.922	response to growth factor
GO:0009966	0.917	regulation of signal transduction
GO:0071363	0.907	cellular response to growth factor stimulus
GO:0032925	0.906	regulation of activin receptor signaling pathway
GO:0010648	0.892	negative regulation of cell communication
GO:0051716	0.890	cellular response to stimulus
GO:0023057	0.886	negative regulation of signaling
GO:0048518	0.876	positive regulation of biological process
GO:2001141	0.856	regulation of RNA biosynthetic process
GO:0007154	0.836	cell communication
GO:0023052	0.827	signaling
GO:0048585	0.825	negative regulation of response to stimulus
GO:0010468	0.820	regulation of gene expression
GO:0048522	0.819	positive regulation of cellular process
GO:1903506	0.817	regulation of nucleic acid-templated transcription
GO:0045596	0.809	negative regulation of cell differentiation
GO:0007165	0.806	signal transduction
GO:0051241	0.788	negative regulation of multicellular organismal process
GO:0048731	0.777	system development
GO:0030154	0.776	cell differentiation
GO:0048513	0.766	animal organ development
GO:0090101	0.755	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051049	0.745	regulation of transport
GO:0051094	0.714	positive regulation of developmental process
GO:0010605	0.708	negative regulation of macromolecule metabolic process
GO:0006355	0.707	regulation of DNA-templated transcription
GO:2000026	0.690	regulation of multicellular organismal development
GO:0051172	0.647	negative regulation of nitrogen compound metabolic process
GO:0007167	0.637	enzyme-linked receptor protein signaling pathway
GO:0048468	0.568	cell development
GO:0009893	0.557	positive regulation of metabolic process
GO:0010604	0.548	positive regulation of macromolecule metabolic process
GO:0009653	0.487	anatomical structure morphogenesis
GO:0051240	0.480	positive regulation of multicellular organismal process
GO:0009888	0.478	tissue development
GO:0031324	0.474	negative regulation of cellular metabolic process
GO:0042221	0.462	response to chemical
GO:0051173	0.414	positive regulation of nitrogen compound metabolic process
GO:0042303	0.402	molting cycle
GO:0007178	0.397	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051128	0.390	regulation of cellular component organization
GO:0006357	0.372	regulation of transcription by RNA polymerase II
GO:0031325	0.362	positive regulation of cellular metabolic process
GO:0065008	0.359	regulation of biological quality
GO:0009890	0.335	negative regulation of biosynthetic process
GO:0045935	0.318	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.316	positive regulation of cellular biosynthetic process
GO:0010558	0.314	negative regulation of macromolecule biosynthetic process
GO:0031327	0.314	negative regulation of cellular biosynthetic process
GO:0045934	0.314	negative regulation of nucleobase-containing compound metabolic process
GO:0045893	0.305	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.974	intracellular anatomical structure
GO:0043227	0.938	membrane-bounded organelle
GO:0043229	0.927	intracellular organelle
GO:0043231	0.917	intracellular membrane-bounded organelle
GO:0005615	0.876	extracellular space
GO:0005634	0.863	nucleus
GO:0005737	0.632	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]