StarFunc result for job id P20020

User Input

>input (1220 residues)
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBC7	0.858	0.858	0.000	1220	1.000	1.000	A0A024RBC7.pdb.gz
2	AFDB:B7CED8	0.805	0.839	0.000	1170	0.565	0.589	B7CED8.pdb.gz	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
3	AFDB:F6PDY7	0.862	0.856	0.000	1228	0.854	0.849	F6PDY7.pdb.gz	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
4	AFDB:G5EFR6	0.781	0.761	0.000	1252	0.505	0.492	G5EFR6.pdb.gz	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
5	AFDB:P11506	0.869	0.853	0.000	1243	0.817	0.802	P11506.pdb.gz	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
6	AFDB:P23634	0.856	0.842	0.000	1241	0.757	0.745	P23634.pdb.gz	AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2
7	AFDB:Q59DP9	0.817	0.795	0.000	1255	0.595	0.578	Q59DP9.pdb.gz	Q59DP9_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=3
8	AFDB:Q6Q477	0.862	0.872	0.000	1205	0.739	0.748	Q6Q477.pdb.gz	AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
9	AFDB:Q95XP5	0.826	0.817	0.000	1234	0.573	0.566	Q95XP5.pdb.gz	Q95XP5_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
10	AFDB:Q9R0K7	0.898	0.915	0.000	1198	0.816	0.831	Q9R0K7.pdb.gz	AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2
11	PDB:6a69A	0.693	0.920	9.758E-104	911	0.739	0.990	6a69A.pdb.gz
12	PDB:7e7sA	0.594	0.698	1.536E-54	1020	0.230	0.275	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
13	PDB:5zmwA	0.569	0.681	1.315E-52	1000	0.224	0.273	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
14	PDB:7x20A	0.518	0.622	1.570E-47	986	0.210	0.260	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
15	PDB:8d3xA	0.494	0.592	2.428E-47	989	0.215	0.265	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
16	PDB:3ixzA	0.501	0.598	5.665E-45	998	0.202	0.247	3ixzA.pdb.gz
17	PDB:3b8eA	0.508	0.606	1.008E-43	998	0.215	0.263	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
18	PDB:7vh5A	0.483	0.695	1.134E-35	804	0.150	0.228	7vh5A.pdb.gz
19	PDB:7vpkA	0.451	0.511	2.448E-32	1055	0.159	0.184	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
20	PDB:6rohA	0.470	0.508	2.076E-31	1112	0.163	0.179	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B7CED8	1340	1170	0.570	0.594	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
2	D6XMU9	570	1080	0.329	0.371	D6XMU9_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.350 PE=3 SV=1
3	E6EK15	1392	1194	0.591	0.604	E6EK15_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
4	E6EK17	1404	1187	0.593	0.610	E6EK17_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
5	E6EK18	1394	1210	0.593	0.598	E6EK18_DROME Calcium-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=PMCA PE=1 SV=1
6	F6PDY7	2006	1228	0.844	0.839	F6PDY7_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=pmca1 PE=1 SV=1
7	F7AAP4	1751	1166	0.713	0.746	F7AAP4_MOUSE Calcium-transporting ATPase OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
8	G5E829	2501	1220	0.995	0.995	AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp2b1 PE=1 SV=1
9	G5EFR6	906	1252	0.378	0.368	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
10	J9VQQ3	595	1414	0.338	0.291	ATC2_CRYNH Calcium-transporting ATPase 2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=PMC1 PE=3 SV=1
11	O64806	647	1015	0.345	0.415	ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA7 PE=3 SV=2
12	O81108	652	1014	0.348	0.418	ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=ACA2 PE=1 SV=1
13	P11505	2498	1220	0.995	0.995	AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2b1 PE=1 SV=3
14	P11506	1985	1243	0.819	0.804	AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2
15	P20020	2510	1220	1.000	1.000	AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4
16	P23634	1852	1241	0.759	0.746	AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2
17	P54678	575	1115	0.285	0.312	ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum OX=44689 GN=patA PE=1 SV=2
18	Q01814	1980	1243	0.816	0.801	AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2B2 PE=1 SV=2
19	Q16720	1942	1220	0.802	0.802	AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3
20	Q37145	628	1020	0.344	0.412	ACA1_ARATH Calcium-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ACA1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12424 ATP_Ca_trans_C	2.3e-23	93.7	Plasma membrane calcium transporter ATPase C terminal
2	PF13246 Cation_ATPase	1.2e-14	65.4	Cation transport ATPase (P-type)
3	PF00689 Cation_ATPase_C	2.1e-41	153.2	Cation transporting ATPase, C-terminus
4	PF00690 Cation_ATPase_N	6.1e-12	56.4	Cation transporter/ATPase, N-terminus
5	PF13203 DUF2201_N	1.4e+02	13.5	Putative metallopeptidase domain
6	PF00122 E1-E2_ATPase	3.7e-29	113.1	E1-E2 ATPase
7	PF00702 Hydrolase	1.4e-10	53.3	haloacid dehalogenase-like hydrolase
8	PF08282 Hydrolase_3	0.0049	28.2	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006741

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000024191	0.848	Calcium-transporting ATPase
2	61853.ENSNLEP00000016255	0.812	Protein kinase, cAMP-dependent, catalytic, alpha
3	61853.ENSNLEP00000010411	0.811	Protein kinase, cGMP-dependent, type II
4	61853.ENSNLEP00000012062	0.810	Belongs to the protein kinase superfamily.
5	61853.ENSNLEP00000014604	0.806	Protein kinase, cGMP-dependent, type I
6	61853.ENSNLEP00000022011	0.804	Calcium-transporting ATPase
7	61853.ENSNLEP00000018167	0.725	Sodium/potassium-transporting ATPase subunit beta
8	61853.ENSNLEP00000017318	0.694	Neuroplastin
9	61853.ENSNLEP00000016383	0.686	Cardiac phospholamban
10	61853.ENSNLEP00000013175	0.666	Troponin I type 3 (cardiac)
11	61853.ENSNLEP00000018228	0.653	ATP-binding cassette, sub-family B (MDR/TAP), member 1
12	61853.ENSNLEP00000003447	0.650	Transient receptor potential cation channel, subfamily V, member 6
13	61853.ENSNLEP00000000357	0.645	Nitric oxide synthase
14	61853.ENSNLEP00000021220	0.639	KIAA0368
15	61853.ENSNLEP00000011610	0.631	S100 calcium binding protein G
16	61853.ENSNLEP00000024040	0.630	Synaptic vesicle glycoprotein 2B
17	61853.ENSNLEP00000004866	0.623	Nitric oxide synthase
18	61853.ENSNLEP00000003277	0.613	Calcium-transporting ATPase
19	61853.ENSNLEP00000013734	0.612	Calcium-transporting ATPase
20	61853.ENSNLEP00000003510	0.611	Transient receptor potential cation channel, subfamily V, member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005388	0.999	P-type calcium transporter activity
GO:0019904	0.601	protein domain specific binding
GO:0097159	0.573	organic cyclic compound binding
GO:0030165	0.571	PDZ domain binding
GO:1901363	0.483	heterocyclic compound binding
GO:0036094	0.482	small molecule binding
GO:0043167	0.386	ion binding
GO:0030554	0.377	adenyl nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006816	0.967	calcium ion transport
GO:0009987	0.962	cellular process
GO:0032501	0.945	multicellular organismal process
GO:0065007	0.935	biological regulation
GO:0050789	0.911	regulation of biological process
GO:0050794	0.840	regulation of cellular process
GO:0048878	0.676	chemical homeostasis
GO:0030003	0.535	intracellular monoatomic cation homeostasis
GO:0098771	0.523	inorganic ion homeostasis
GO:0032502	0.477	developmental process
GO:0055074	0.468	calcium ion homeostasis
GO:0048856	0.455	anatomical structure development
GO:0006874	0.453	intracellular calcium ion homeostasis
GO:0048518	0.407	positive regulation of biological process
GO:0050896	0.394	response to stimulus
GO:0034220	0.348	monoatomic ion transmembrane transport
GO:0007275	0.338	multicellular organism development
GO:0065008	0.321	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.944	organelle
GO:0005622	0.807	intracellular anatomical structure
GO:0005737	0.782	cytoplasm
GO:0043227	0.775	membrane-bounded organelle
GO:0043229	0.717	intracellular organelle
GO:0043231	0.681	intracellular membrane-bounded organelle
GO:0031981	0.362	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.999	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.999	P-type Ca(2+) transporter.

[back to server]