StarFunc result for job id P20023

User Input

>input (1033 residues)
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKE
TCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
RSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
SQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQ
WNPPLAVCRSRSLAPVLCGIAAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEA
REVYSVDPYNPAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2gsxA	0.134	0.142	0.000	951	0.921	1.000	2gsxA.pdb.gz
2	AFDB:D3Z9F7	0.290	0.291	0.000	1029	0.651	0.653	D3Z9F7.pdb.gz	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
3	AFDB:P19070	0.304	0.306	0.000	1025	0.653	0.659	P19070.pdb.gz	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
4	AFDB:P20023	1.000	1.000	0.000	1033	1.000	1.000	P20023.pdb.gz	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
5	AFDB:P17927	0.163	0.092	2.048E-74	2039	0.387	0.196	P17927.pdb.gz	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
6	PDB:2q7zA	0.124	0.085	7.315E-60	1931	0.324	0.173	2q7zA.pdb.gz
7	AFDB:P08603	0.157	0.134	1.233E-48	1231	0.230	0.193	P08603.pdb.gz	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
8	AFDB:P06909	0.135	0.116	3.598E-48	1234	0.241	0.202	P06909.pdb.gz	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
9	AFDB:Q91YB6	0.131	0.113	1.223E-46	1236	0.220	0.184	Q91YB6.pdb.gz	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
10	AFDB:E9Q8B5	0.151	0.172	1.688E-43	879	0.213	0.250	E9Q8B5.pdb.gz	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
11	AFDB:E9Q8B6	0.152	0.184	1.426E-40	820	0.200	0.252	E9Q8B6.pdb.gz	E9Q8B6_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
12	AFDB:Q9VYR4	0.125	0.112	1.559E-40	1174	0.208	0.183	Q9VYR4.pdb.gz	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
13	PDB:1haqA	0.124	0.109	3.307E-35	1213	0.207	0.176	1haqA.pdb.gz
14	PDB:1c1zA	0.135	0.364	1.101E-17	326	0.073	0.230	1c1zA.pdb.gz
15	PDB:8a7eC	0.103	0.077	1.495E-10	1524	0.076	0.052	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.068	0.095	2.423E-8	714	0.042	0.060	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:8a7dQ	0.083	0.200	4.820E-7	273	0.038	0.143	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:4e0sB	0.093	0.104	6.888E-7	898	0.053	0.061	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:3t5oA	0.064	0.071	2.403E-6	871	0.042	0.049	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:7nycC	0.069	0.084	3.141E-6	809	0.041	0.052	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z9F7	0.0	1391	1406	0.642	0.472	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
2	P19070	0.0	1411	1025	0.653	0.659	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
3	P20023	0.0	2133	1033	1.000	1.000	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
4	P17927	2.11e-159	520	2039	0.318	0.161	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
5	Q4LDE5	1.21e-90	322	3571	0.278	0.080	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
6	Q80T79	1.84e-88	315	3707	0.277	0.077	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
7	A2AVA0	3.12e-88	314	3567	0.273	0.079	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
8	A0A1D5NSM8	1.99e-87	312	3615	0.261	0.075	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
9	Q923L3	7.11e-84	301	3564	0.258	0.075	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
10	Q96PZ7	6.58e-78	283	3564	0.261	0.076	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
11	Q63135	2.21e-64	230	559	0.138	0.256	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
12	P04003	2.49e-64	231	597	0.167	0.288	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2
13	Q63514	3.55e-64	229	558	0.171	0.317	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
14	Q2VPA4	3.61e-64	229	569	0.151	0.274	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
15	Q7TSY4	7.08e-52	194	577	0.158	0.282	ZP3R_RAT Zona pellucida sperm-binding protein 3 receptor OS=Rattus norvegicus OX=10116 GN=Zp3r PE=2 SV=1
16	E5DV48	3.59e-51	197	868	0.169	0.202	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
17	Q60736	2.48e-49	187	579	0.159	0.283	ZP3R_MOUSE Zona pellucida sperm-binding protein 3 receptor OS=Mus musculus OX=10090 GN=Zp3r PE=1 SV=1
18	P16109	2.76e-49	191	830	0.167	0.208	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
19	O08569	6.96e-44	170	533	0.120	0.233	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
20	Q64735	7.86e-44	168	483	0.106	0.226	CR1L_MOUSE Complement component receptor 1-like protein OS=Mus musculus OX=10090 GN=Cr1l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03604 DNA_RNApol_7kD	3.8e+02	12.2	DNA directed RNA polymerase, 7 kDa subunit
2	PF00084 Sushi	9.3e-136	453.7	Sushi repeat (SCR repeat)
3	PF05473 UL45	2.2e+02	12.9	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437940	0.999	B-lymphocyte antigen CD19
2	9606.ENSP00000245907	0.997	Complement C3
3	9606.ENSP00000263645	0.997	CD81 antigen
4	9606.ENSP00000264072	0.979	Low affinity immunoglobulin epsilon Fc receptor
5	9606.ENSP00000386187	0.914	Interferon-induced transmembrane protein 1
6	9606.ENSP00000342681	0.895	T-cell surface glycoprotein CD5
7	9606.ENSP00000276927	0.841	Interferon alpha-1/13
8	9606.ENSP00000411355	0.833	Receptor-type tyrosine-protein phosphatase C
9	9606.ENSP00000011653	0.826	T-cell surface glycoprotein CD4
10	9606.ENSP00000353238	0.822	Leukosialin
11	9606.ENSP00000266557	0.808	CD27 antigen
12	9606.ENSP00000085219	0.798	B-cell receptor CD22
13	9606.ENSP00000386559	0.786	T-cell surface glycoprotein CD8 alpha chain
14	9606.ENSP00000418525	0.784	Neprilysin
15	9606.ENSP00000441691	0.772	Integrin alpha-M
16	9606.ENSP00000370542	0.767	Syndecan-1
17	9606.ENSP00000226279	0.766	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
18	9606.ENSP00000221972	0.759	B-cell antigen receptor complex-associated protein alpha chain
19	9606.ENSP00000361359	0.755	Tumor necrosis factor receptor superfamily member 5
20	9606.ENSP00000357153	0.734	Antigen-presenting glycoprotein CD1d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140375	1.000	immune receptor activity
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0001848	0.965	complement binding
GO:0042802	0.903	identical protein binding
GO:1901363	0.886	heterocyclic compound binding
GO:0097159	0.886	organic cyclic compound binding
GO:0003676	0.862	nucleic acid binding
GO:0046983	0.858	protein dimerization activity
GO:0042803	0.814	protein homodimerization activity
GO:0003677	0.796	DNA binding
GO:0004875	0.540	complement receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050896	0.992	response to stimulus
GO:0009987	0.991	cellular process
GO:0006955	0.977	immune response
GO:0048856	0.967	anatomical structure development
GO:0032501	0.961	multicellular organismal process
GO:0046649	0.933	lymphocyte activation
GO:0009605	0.917	response to external stimulus
GO:0048518	0.910	positive regulation of biological process
GO:0002684	0.899	positive regulation of immune system process
GO:0048583	0.890	regulation of response to stimulus
GO:0048584	0.883	positive regulation of response to stimulus
GO:0050776	0.882	regulation of immune response
GO:0006950	0.866	response to stress
GO:0002252	0.855	immune effector process
GO:0030097	0.843	hemopoiesis
GO:0050794	0.826	regulation of cellular process
GO:0002521	0.826	leukocyte differentiation
GO:0009607	0.811	response to biotic stimulus
GO:0044419	0.794	biological process involved in interspecies interaction between organisms
GO:0042113	0.791	B cell activation
GO:1903131	0.737	mononuclear cell differentiation
GO:0006959	0.735	humoral immune response
GO:0030098	0.733	lymphocyte differentiation
GO:0050778	0.709	positive regulation of immune response
GO:0070661	0.707	leukocyte proliferation
GO:0043207	0.663	response to external biotic stimulus
GO:0006952	0.633	defense response
GO:0030183	0.581	B cell differentiation
GO:0051707	0.575	response to other organism
GO:0002253	0.570	activation of immune response
GO:0042100	0.513	B cell proliferation
GO:0048522	0.425	positive regulation of cellular process
GO:0051716	0.408	cellular response to stimulus
GO:0019222	0.356	regulation of metabolic process
GO:0048519	0.331	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.992	extracellular region
GO:0043227	0.988	membrane-bounded organelle
GO:0009986	0.953	cell surface
GO:0032991	0.952	protein-containing complex
GO:0005615	0.945	extracellular space
GO:0031982	0.935	vesicle
GO:0070062	0.895	extracellular exosome
GO:0005622	0.724	intracellular anatomical structure
GO:0005737	0.698	cytoplasm
GO:0043231	0.673	intracellular membrane-bounded organelle
GO:0043235	0.542	receptor complex
GO:0098552	0.312	side of membrane
GO:0009897	0.300	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]