StarFunc result for job id P20036

User Input

>input (260 residues)
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20036	1.000	1.000	1.178E-45	260	1.000	1.000	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
2	AFDB:P01903	0.763	0.780	1.474E-30	254	0.569	0.583	P01903.pdb.gz	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
3	AFDB:P01909	0.701	0.717	1.731E-30	254	0.565	0.579	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
4	AFDB:P01910	0.697	0.708	2.515E-30	256	0.577	0.586	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
5	AFDB:P01904	0.858	0.874	3.855E-30	255	0.538	0.549	P01904.pdb.gz	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
6	AFDB:P01906	0.734	0.748	4.067E-30	255	0.542	0.553	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
7	AFDB:P06340	0.692	0.719	3.631E-29	250	0.523	0.544	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
8	AFDB:P20037	0.688	0.699	1.002E-28	256	0.558	0.566	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
9	AFDB:B2RST7	0.681	0.706	1.308E-28	250	0.473	0.492	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
10	PDB:6cplA	0.663	0.946	1.247E-25	180	0.442	0.639	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
11	AFDB:P28078	0.615	0.613	2.194E-17	261	0.277	0.276	P28078.pdb.gz	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
12	PDB:5j6hA	0.357	0.339	9.650E-11	275	0.169	0.160	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6fgbA	0.343	0.337	7.745E-10	265	0.173	0.170	6fgbA.pdb.gz
14	PDB:6e1iA	0.364	0.254	1.187E-9	389	0.188	0.126	6e1iA.pdb.gz
15	PDB:6d7gA	0.355	0.246	3.644E-9	386	0.165	0.111	6d7gA.pdb.gz
16	PDB:2qriA	0.367	0.247	4.759E-9	398	0.146	0.095	2qriA.pdb.gz
17	PDB:3nwmA	0.360	0.251	5.892E-9	384	0.169	0.115	3nwmA.pdb.gz
18	PDB:1kjvB	0.358	0.900	6.215E-9	100	0.115	0.300	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
19	PDB:6mp0A	0.365	0.252	6.916E-9	388	0.158	0.106	6mp0A.pdb.gz
20	PDB:3es6A	0.354	0.335	1.005E-8	277	0.154	0.144	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20036	0.0	540	260	1.000	1.000	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
2	Q95HB9	0.0	525	260	0.973	0.973	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
3	X5CKE2	0.0	540	260	1.000	1.000	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
4	J3KQ99	3.34e-158	439	209	0.804	1.000	J3KQ99_HUMAN Major histocompatibility complex, class II, DP alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
5	P14434	1.77e-105	308	256	0.585	0.594	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
6	P01910	5.20e-103	301	256	0.581	0.590	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
7	P01909	3.34e-101	297	254	0.565	0.579	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
8	P20037	3.57e-101	297	256	0.562	0.570	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
9	P04228	3.65e-101	297	256	0.573	0.582	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
10	P23150	5.22e-101	296	254	0.573	0.587	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
11	P14439	8.14e-99	291	255	0.538	0.549	HA23_MOUSE H-2 class II histocompatibility antigen, E-U alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=2 SV=2
12	P01904	1.75e-98	290	255	0.542	0.553	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
13	P14436	3.19e-98	288	233	0.538	0.601	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
14	P14435	3.16e-97	286	233	0.538	0.601	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
15	P14438	4.08e-97	285	227	0.523	0.599	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
16	P14437	1.58e-96	284	233	0.531	0.592	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
17	P06340	2.56e-96	284	250	0.531	0.552	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
18	P01906	1.63e-95	282	255	0.523	0.533	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
19	P01903	1.72e-95	282	254	0.569	0.583	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
20	P04227	5.82e-94	277	221	0.512	0.602	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3.2e-21	86.8	Immunoglobulin C1-set domain
2	PF13927 Ig_3	0.17	23.8	Immunoglobulin domain
3	PF00993 MHC_II_alpha	2.2e-30	115.5	Class II histocompatibility antigen, alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408146	0.996	HLA class II histocompatibility antigen, DP beta 1 chain
2	9606.ENSP00000009530	0.980	HLA class II histocompatibility antigen gamma chain
3	9606.ENSP00000398890	0.979	HLA class II histocompatibility antigen, DM beta chain
4	9606.ENSP00000353099	0.977	HLA class II histocompatibility antigen, DRB1-15 beta chain
5	9606.ENSP00000390431	0.956	Major histocompatibility complex, class II, DQ beta 2
6	9606.ENSP00000378786	0.955	HLA class II histocompatibility antigen, DR alpha chain
7	9606.ENSP00000365817	0.953	HLA class I histocompatibility antigen, alpha chain E
8	9606.ENSP00000363976	0.952	HLA class II histocompatibility antigen, DM alpha chain
9	9606.ENSP00000379873	0.948	HLA class I histocompatibility antigen, A-3 alpha chain
10	9606.ENSP00000399168	0.941	HLA class I histocompatibility antigen, B-7 alpha chain
11	9606.ENSP00000357981	0.937	Cathepsin S
12	9606.ENSP00000259951	0.936	HLA class I histocompatibility antigen, alpha chain F
13	9606.ENSP00000365402	0.935	HLA class I histocompatibility antigen, Cw-7 alpha chain
14	9606.ENSP00000390020	0.933	HLA class II histocompatibility antigen, DO beta chain
15	9606.ENSP00000411355	0.928	Receptor-type tyrosine-protein phosphatase C
16	9606.ENSP00000220166	0.925	Pro-cathepsin H
17	9606.ENSP00000370989	0.924	Programmed cell death 1 ligand 1
18	9606.ENSP00000352833	0.923	Tyrosine-protein phosphatase non-receptor type 22
19	9606.ENSP00000380855	0.919	Programmed cell death 1 ligand 2
20	9606.ENSP00000229829	0.918	HLA class II histocompatibility antigen, DO alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042605	0.999	peptide antigen binding
GO:0044877	0.740	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0002376	0.980	immune system process
GO:0002682	0.979	regulation of immune system process
GO:0048518	0.961	positive regulation of biological process
GO:0050863	0.955	regulation of T cell activation
GO:0002684	0.951	positive regulation of immune system process
GO:0048002	0.943	antigen processing and presentation of peptide antigen
GO:0022407	0.936	regulation of cell-cell adhesion
GO:0019884	0.927	antigen processing and presentation of exogenous antigen
GO:0050870	0.925	positive regulation of T cell activation
GO:0002478	0.921	antigen processing and presentation of exogenous peptide antigen
GO:0009987	0.906	cellular process
GO:0002504	0.905	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0050896	0.904	response to stimulus
GO:0002495	0.903	antigen processing and presentation of peptide antigen via MHC class II
GO:0019886	0.849	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0051716	0.484	cellular response to stimulus
GO:0019222	0.483	regulation of metabolic process
GO:0006955	0.470	immune response
GO:0060255	0.465	regulation of macromolecule metabolic process
GO:0048519	0.462	negative regulation of biological process
GO:0048583	0.427	regulation of response to stimulus
GO:1903706	0.427	regulation of hemopoiesis
GO:0050776	0.423	regulation of immune response
GO:1902105	0.423	regulation of leukocyte differentiation
GO:0048584	0.315	positive regulation of response to stimulus
GO:0045580	0.307	regulation of T cell differentiation
GO:0009893	0.306	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0032991	0.975	protein-containing complex
GO:0031090	0.952	organelle membrane
GO:0031982	0.937	vesicle
GO:0031410	0.889	cytoplasmic vesicle
GO:0098588	0.874	bounding membrane of organelle
GO:0005764	0.865	lysosome
GO:0030135	0.851	coated vesicle
GO:0098796	0.850	membrane protein complex
GO:0030662	0.829	coated vesicle membrane
GO:0031984	0.792	organelle subcompartment
GO:0098552	0.770	side of membrane
GO:0005783	0.761	endoplasmic reticulum
GO:0098797	0.753	plasma membrane protein complex
GO:0000139	0.750	Golgi membrane
GO:0030139	0.724	endocytic vesicle
GO:0030133	0.706	transport vesicle
GO:0005765	0.703	lysosomal membrane
GO:0030666	0.696	endocytic vesicle membrane
GO:0005789	0.691	endoplasmic reticulum membrane
GO:0009986	0.675	cell surface
GO:0030658	0.658	transport vesicle membrane
GO:0030134	0.640	COPII-coated ER to Golgi transport vesicle
GO:0042611	0.615	MHC protein complex
GO:0042613	0.574	MHC class II protein complex
GO:0030136	0.409	clathrin-coated vesicle
GO:0098553	0.405	lumenal side of endoplasmic reticulum membrane
GO:0045334	0.391	clathrin-coated endocytic vesicle
GO:0030665	0.364	clathrin-coated vesicle membrane
GO:0030669	0.354	clathrin-coated endocytic vesicle membrane
GO:0012507	0.353	ER to Golgi transport vesicle membrane
GO:0032588	0.346	trans-Golgi network membrane
GO:0009897	0.317	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]