StarFunc result for job id P20042

User Input

>input (333 residues)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20042	1.000	1.000	3.940E-51	333	1.000	1.000	P20042.pdb.gz	IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2
2	AFDB:P09064	0.450	0.524	1.624E-23	285	0.360	0.421	P09064.pdb.gz	IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI3 PE=1 SV=2
3	PDB:7a094	0.399	0.881	6.813E-21	144	0.429	0.993	7a094.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
4	PDB:6fyxl	0.352	0.874	1.642E-13	128	0.225	0.586	6fyxl.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
5	PDB:2d74B	0.330	0.774	4.979E-12	137	0.165	0.401	2d74B.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
6	PDB:6fyxm	0.315	0.678	6.643E-9	147	0.087	0.197	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
7	PDB:5aj0Ap	0.104	0.284	6.717E-2	91	0.042	0.154	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
8	PDB:5yhvA	0.142	0.125	7.147E-2	394	0.057	0.048	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
9	PDB:4v6wCp	0.106	0.301	8.609E-2	91	0.030	0.110	4v6wCp.pdb.gz	Structures of the human and Drosophila 80S ribosome.
10	PDB:7nvw2	0.137	0.121	1.037E-1	390	0.066	0.056	7nvw2.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
11	PDB:1ek8A	0.111	0.188	1.103E-1	185	0.015	0.027	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
12	PDB:6vpqA	0.146	0.455	1.329E-1	87	0.033	0.126	6vpqA.pdb.gz	Crystal structure of the C-terminal domain of DENR.
13	AFDB:Q8MSX1	0.090	0.024	2.137E-1	1818	0.156	0.029	Q8MSX1.pdb.gz	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2
14	AFDB:F1NQJ3	0.114	0.049	3.510E-1	869	0.132	0.051	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
15	AFDB:P50887	0.160	0.172	3.973E-1	299	0.102	0.114	P50887.pdb.gz	RL22_DROME Large ribosomal subunit protein eL22 OS=Drosophila melanogaster OX=7227 GN=RpL22 PE=1 SV=2
16	AFDB:O59784	0.104	0.060	4.228E-1	761	0.129	0.057	O59784.pdb.gz	MDE7_SCHPO RNA-binding protein mde7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mde7 PE=4 SV=1
17	AFDB:O14019	0.076	0.050	6.134E-1	636	0.123	0.064	O14019.pdb.gz	HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hal4 PE=1 SV=1
18	AFDB:P27692	0.103	0.040	6.134E-1	1063	0.150	0.047	P27692.pdb.gz	SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT5 PE=1 SV=1
19	AFDB:Q5BF66	0.094	0.058	6.134E-1	618	0.126	0.068	Q5BF66.pdb.gz	Q5BF66_EMENI Cell division cycle protein Cdc20, putative (AFU_orthologue AFUA_1G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00814 PE=3 SV=1
20	AFDB:A0A0G2K5P5	0.085	0.026	6.527E-1	1688	0.138	0.027	A0A0G2K5P5.pdb.gz	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A6W5	0.0	654	332	0.958	0.961	A0A8I6A6W5_RAT Eukaryotic translation initiation factor 2 subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2s2 PE=1 SV=1
2	A0A8I6G5P0	0.0	655	347	0.955	0.916	A0A8I6G5P0_RAT Eukaryotic translation initiation factor 2 subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2s2 PE=1 SV=1
3	P20042	0.0	680	333	1.000	1.000	IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2
4	Q99L45	0.0	651	331	0.955	0.961	IF2B_MOUSE Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus OX=10090 GN=Eif2s2 PE=1 SV=1
5	P41375	1.86e-99	297	312	0.405	0.433	IF2B_DROME Eukaryotic translation initiation factor 2 subunit 2 OS=Drosophila melanogaster OX=7227 GN=eIF2beta PE=1 SV=1
6	Q21230	1.14e-75	234	250	0.312	0.416	IF2B_CAEEL Eukaryotic translation initiation factor 2 subunit 2 OS=Caenorhabditis elegans OX=6239 GN=eif-2beta PE=3 SV=4
7	Q41969	5.10e-73	228	268	0.321	0.399	IF2B_ARATH Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=EIF2B PE=1 SV=3
8	P56329	2.38e-68	218	321	0.300	0.312	IF2B_SCHPO Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif212 PE=1 SV=2
9	P09064	5.09e-55	183	285	0.327	0.382	IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI3 PE=1 SV=2
10	Q8U3I5	4.42e-26	103	140	0.168	0.400	IF2B_PYRFU Translation initiation factor 2 subunit beta OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2b PE=1 SV=1
11	Q57Z81	1.17e-18	87.0	313	0.153	0.163	Q57Z81_TRYB2 Translation initiation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.120 PE=3 SV=1
12	Q9S825	1.10e-07	55.5	437	0.078	0.059	IF5Z_ARATH Probable eukaryotic translation initiation factor 5-2 OS=Arabidopsis thaliana OX=3702 GN=At1g77840 PE=1 SV=1
13	H0YN40	6.38e-07	51.6	200	0.081	0.135	H0YN40_HUMAN Eukaryotic translation initiation factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=1
14	P38431	7.28e-07	52.8	405	0.096	0.079	IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF5 PE=1 SV=1
15	H0YLZ1	1.92e-06	48.9	146	0.081	0.185	H0YLZ1_HUMAN Eukaryotic translation initiation factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=1
16	Q07205	2.45e-06	51.2	429	0.081	0.063	IF5_RAT Eukaryotic translation initiation factor 5 OS=Rattus norvegicus OX=10116 GN=Eif5 PE=1 SV=1
17	P59325	2.49e-06	51.2	429	0.081	0.063	IF5_MOUSE Eukaryotic translation initiation factor 5 OS=Mus musculus OX=10090 GN=Eif5 PE=1 SV=1
18	Q09689	2.69e-06	50.8	395	0.084	0.071	IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif5 PE=3 SV=1
19	P55010	2.71e-06	51.2	431	0.081	0.063	IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2
20	Q22918	5.09e-06	50.1	436	0.078	0.060	IF5_CAEEL Eukaryotic translation initiation factor 5 OS=Caenorhabditis elegans OX=6239 GN=C37C3.2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14537 Cytochrom_c3_2	1.2e+02	14.6	Cytochrome c3
2	PF01873 eIF-5_eIF-2B	2.4e-37	138.8	Domain found in IF2B/IF5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
2	9606.ENSP00000253108	0.999	Eukaryotic translation initiation factor 3 subunit G
3	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
4	9606.ENSP00000273783	0.999	Translation initiation factor eIF-2B subunit epsilon
5	9606.ENSP00000353575	0.999	Translation initiation factor eIF-2B subunit gamma
6	9606.ENSP00000358140	0.999	Eukaryotic translation initiation factor 3 subunit A
7	9606.ENSP00000416250	0.999	Translation initiation factor eIF-2B subunit alpha
8	9606.ENSP00000419449	0.999	Eukaryotic translation initiation factor 1
9	9606.ENSP00000216554	0.998	Eukaryotic translation initiation factor 5
10	9606.ENSP00000354125	0.998	Eukaryotic translation initiation factor 3 subunit B
11	9606.ENSP00000368927	0.998	Eukaryotic translation initiation factor 1A, X-chromosomal
12	9606.ENSP00000433664	0.998	Eukaryotic translation initiation factor 4 gamma 2
13	9606.ENSP00000332604	0.997	Eukaryotic translation initiation factor 3 subunit C
14	9606.ENSP00000394869	0.997	Translation initiation factor eIF-2B subunit delta
15	9606.ENSP00000416255	0.997	Eukaryotic translation initiation factor 4 gamma 1
16	9606.ENSP00000266126	0.996	Translation initiation factor eIF-2B subunit beta
17	9606.ENSP00000293831	0.996	Eukaryotic initiation factor 4A-I
18	9606.ENSP00000362688	0.995	Eukaryotic translation initiation factor 3 subunit I
19	9606.ENSP00000417229	0.994	Eukaryotic translation initiation factor 2A
20	9606.ENSP00000379888	0.987	Ribosomal protein S8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.845	RNA binding
GO:0008135	0.717	translation factor activity, RNA binding
GO:0003743	0.698	translation initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0032502	0.994	developmental process
GO:0009987	0.991	cellular process
GO:0048856	0.923	anatomical structure development
GO:0007275	0.913	multicellular organism development
GO:0048731	0.844	system development
GO:0071704	0.751	organic substance metabolic process
GO:0043170	0.689	macromolecule metabolic process
GO:0044237	0.687	cellular metabolic process
GO:0006807	0.673	nitrogen compound metabolic process
GO:0044238	0.630	primary metabolic process
GO:0010467	0.606	gene expression
GO:0034641	0.578	cellular nitrogen compound metabolic process
GO:1901564	0.556	organonitrogen compound metabolic process
GO:0044271	0.541	cellular nitrogen compound biosynthetic process
GO:0019538	0.537	protein metabolic process
GO:1901576	0.535	organic substance biosynthetic process
GO:0043603	0.529	amide metabolic process
GO:0044260	0.513	cellular macromolecule metabolic process
GO:0043604	0.508	amide biosynthetic process
GO:0006412	0.493	translation
GO:0065007	0.423	biological regulation
GO:0007548	0.352	sex differentiation
GO:0050789	0.343	regulation of biological process
GO:0045137	0.339	development of primary sexual characteristics
GO:0008406	0.334	gonad development
GO:0043009	0.332	chordate embryonic development
GO:0071840	0.320	cellular component organization or biogenesis
GO:0008283	0.320	cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0032991	0.996	protein-containing complex
GO:0005829	0.993	cytosol
GO:0043226	0.797	organelle
GO:0043233	0.789	organelle lumen
GO:0016020	0.770	membrane
GO:0043229	0.763	intracellular organelle
GO:0005634	0.660	nucleus
GO:0031981	0.622	nuclear lumen
GO:0005654	0.587	nucleoplasm
GO:0030054	0.556	cell junction
GO:0043232	0.435	intracellular non-membrane-bounded organelle
GO:0045202	0.397	synapse
GO:0005850	0.380	eukaryotic translation initiation factor 2 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]