StarFunc result for job id P20138

User Input

>input (364 residues)
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20138	1.000	1.000	2.610E-68	364	1.000	1.000	P20138.pdb.gz	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
2	AFDB:Q9Y286	0.589	0.461	3.691E-38	467	0.533	0.415	Q9Y286.pdb.gz	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
3	AFDB:Q9NYZ4	0.586	0.430	3.820E-36	499	0.560	0.409	Q9NYZ4.pdb.gz	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
4	AFDB:Q9Y336	0.572	0.454	1.728E-35	463	0.527	0.415	Q9Y336.pdb.gz	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
5	AFDB:Q96PQ1	0.571	0.354	5.285E-35	595	0.489	0.299	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
6	AFDB:B7ZMQ6	0.553	0.605	7.732E-34	332	0.418	0.458	B7ZMQ6.pdb.gz	B7ZMQ6_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
7	AFDB:Q920G3	0.579	0.377	1.599E-33	569	0.514	0.329	Q920G3.pdb.gz	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
8	AFDB:A0A024R4K4	0.524	0.426	2.957E-33	453	0.582	0.468	A0A024R4K4.pdb.gz
9	AFDB:O15389	0.501	0.343	2.957E-33	551	0.525	0.347	O15389.pdb.gz	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
10	AFDB:Q91Y57	0.576	0.452	3.911E-33	467	0.448	0.349	Q91Y57.pdb.gz	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
11	PDB:1ngwH	0.225	0.353	1.937E-9	216	0.110	0.185	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
12	PDB:2ig2H	0.238	0.350	2.048E-9	238	0.121	0.185	2ig2H.pdb.gz
13	PDB:5c7kF	0.235	0.375	2.864E-9	212	0.085	0.146	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
14	PDB:5c6wJ	0.225	0.332	4.479E-9	238	0.093	0.143	5c6wJ.pdb.gz
15	PDB:6dcvA	0.238	0.369	7.833E-9	220	0.082	0.136	6dcvA.pdb.gz
16	PDB:1gafL	0.231	0.364	1.158E-8	214	0.071	0.121	1gafL.pdb.gz	The immunological evolution of catalysis.
17	PDB:3bn9F	0.233	0.355	1.449E-8	224	0.099	0.161	3bn9F.pdb.gz
18	PDB:5nqkB	0.237	0.340	2.026E-8	242	0.080	0.120	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
19	PDB:7cztH	0.247	0.384	2.026E-8	221	0.096	0.158	7cztH.pdb.gz
20	PDB:6dldD	0.208	0.272	2.266E-8	269	0.099	0.134	6dldD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20138	0.0	758	364	1.000	1.000	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
2	Q546G0	0.0	758	364	1.000	1.000	Q546G0_HUMAN CD33 antigen (Gp67) OS=Homo sapiens OX=9606 GN=CD33 PE=4 SV=1
3	B4DF51	5.23e-110	322	212	0.464	0.797	B4DF51_HUMAN CD33 molecule OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=1
4	O43699	2.08e-104	316	453	0.442	0.355	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2
5	Q9Y286	5.35e-93	287	467	0.385	0.300	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
6	Q9Y336	1.02e-92	286	463	0.390	0.307	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
7	Q9NYZ4	2.17e-91	284	499	0.415	0.303	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
8	Q96PQ1	4.69e-91	286	595	0.385	0.235	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
9	Q4QQK7	5.34e-90	274	309	0.415	0.489	Q4QQK7_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
10	Q3Y597	8.33e-90	274	309	0.415	0.489	Q3Y597_MOUSE SIGLEC-H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
11	B7ZMQ6	7.14e-86	265	332	0.409	0.449	B7ZMQ6_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
12	G3X9N0	4.04e-84	259	293	0.398	0.495	G3X9N0_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=4 SV=1
13	Q920G3	4.23e-84	268	569	0.390	0.250	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
14	A0A4W8	4.43e-83	256	293	0.393	0.488	A0A4W8_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
15	Q08ET2	1.62e-82	258	396	0.365	0.336	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
16	O15389	2.04e-77	249	551	0.357	0.236	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
17	Q91Y57	2.24e-77	247	467	0.338	0.263	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
18	Q96LC7	1.62e-67	227	697	0.302	0.158	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
19	Q96RL6	1.96e-59	205	698	0.297	0.155	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
20	A6NMB1	1.37e-58	199	481	0.280	0.212	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	2.7	19.4	CD80-like C2-set immunoglobulin domain
2	PF06197 DUF998	10	17.2	Protein of unknown function (DUF998)
3	PF07679 I-set	4.4e+02	12.4	Immunoglobulin I-set domain
4	PF00047 ig	5.2e-09	47.5	Immunoglobulin domain
5	PF13927 Ig_3	0.14	24.1	Immunoglobulin domain
6	PF01034 Syndecan	7.3e+02	11.5	Syndecan domain
7	PF07686 V-set	7.8e-12	56.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300060	0.905	Aminopeptidase N
2	9606.ENSP00000391592	0.890	Tyrosine-protein phosphatase non-receptor type 6
3	9606.ENSP00000310036	0.870	Hematopoietic progenitor cell antigen CD34
4	9606.ENSP00000437940	0.865	B-lymphocyte antigen CD19
5	9606.ENSP00000312027	0.862	T-cell antigen CD7
6	9606.ENSP00000351602	0.861	Alpha-(1,3)-fucosyltransferase 4
7	9606.ENSP00000441691	0.832	Integrin alpha-M
8	9606.ENSP00000362205	0.829	Triggering receptor expressed on myeloid cells 2
9	9606.ENSP00000411355	0.829	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000262629	0.823	TYRO protein tyrosine kinase-binding protein
11	9606.ENSP00000226279	0.812	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
12	9606.ENSP00000327890	0.805	Interleukin-3 receptor subunit alpha
13	9606.ENSP00000480132	0.804	Neural cell adhesion molecule 1
14	9606.ENSP00000358165	0.778	High affinity immunoglobulin gamma Fc receptor I
15	9606.ENSP00000340944	0.776	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000225275	0.774	Myeloperoxidase
17	9606.ENSP00000356946	0.772	Low affinity immunoglobulin gamma Fc region receptor III-A
18	9606.ENSP00000418525	0.769	Neprilysin
19	9606.ENSP00000377015	0.764	Phosphatidylinositol-binding clathrin assembly protein
20	9606.ENSP00000358490	0.761	T-cell surface antigen CD2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.926	signaling receptor activity
GO:0043167	0.708	ion binding
GO:0043177	0.692	organic acid binding
GO:0043168	0.655	anion binding
GO:0033691	0.629	sialic acid binding
GO:0019899	0.427	enzyme binding
GO:0019902	0.313	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.989	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0007154	0.973	cell communication
GO:0019222	0.943	regulation of metabolic process
GO:0051716	0.922	cellular response to stimulus
GO:0051049	0.917	regulation of transport
GO:0023052	0.914	signaling
GO:0060255	0.896	regulation of macromolecule metabolic process
GO:0048518	0.887	positive regulation of biological process
GO:0007165	0.887	signal transduction
GO:0001817	0.880	regulation of cytokine production
GO:0048583	0.872	regulation of response to stimulus
GO:0048523	0.870	negative regulation of cellular process
GO:0048522	0.849	positive regulation of cellular process
GO:0009893	0.635	positive regulation of metabolic process
GO:0065009	0.588	regulation of molecular function
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0002694	0.524	regulation of leukocyte activation
GO:0009892	0.503	negative regulation of metabolic process
GO:0080090	0.484	regulation of primary metabolic process
GO:0010605	0.481	negative regulation of macromolecule metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0042127	0.479	regulation of cell population proliferation
GO:0031323	0.466	regulation of cellular metabolic process
GO:0050776	0.415	regulation of immune response
GO:0019220	0.415	regulation of phosphate metabolic process
GO:0044093	0.413	positive regulation of molecular function
GO:0051247	0.412	positive regulation of protein metabolic process
GO:0031399	0.411	regulation of protein modification process
GO:0031325	0.408	positive regulation of cellular metabolic process
GO:0051241	0.403	negative regulation of multicellular organismal process
GO:0050790	0.374	regulation of catalytic activity
GO:0051240	0.315	positive regulation of multicellular organismal process
GO:1903555	0.309	regulation of tumor necrosis factor superfamily cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031981	0.991	nuclear lumen
GO:0005654	0.975	nucleoplasm
GO:0005737	0.916	cytoplasm
GO:0012505	0.742	endomembrane system
GO:0009986	0.715	cell surface
GO:0031982	0.663	vesicle
GO:0031090	0.599	organelle membrane
GO:0031410	0.553	cytoplasmic vesicle
GO:0098588	0.474	bounding membrane of organelle
GO:0030659	0.390	cytoplasmic vesicle membrane
GO:0030141	0.337	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]