StarFunc result for job id P20151

User Input

>input (261 residues)
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWV
LTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHD
LMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLS
NDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP
AVYTKVVHYRKWIKDTIAANP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20151	1.000	1.000	3.975E-54	261	1.000	1.000	P20151.pdb.gz	KLK2_HUMAN Kallikrein-2 OS=Homo sapiens OX=9606 GN=KLK2 PE=1 SV=1
2	AFDB:P07288	0.957	0.957	2.345E-47	261	0.770	0.770	P07288.pdb.gz	KLK3_HUMAN Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2
3	PDB:4nffA	0.872	0.994	6.905E-46	229	0.874	0.996	4nffA.pdb.gz	Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
4	AFDB:P06870	0.940	0.937	4.196E-42	262	0.659	0.656	P06870.pdb.gz	KLK1_HUMAN Kallikrein-1 OS=Homo sapiens OX=9606 GN=KLK1 PE=1 SV=2
5	AFDB:P00755	0.940	0.940	5.385E-41	261	0.598	0.598	P00755.pdb.gz	K1KB1_MOUSE Kallikrein 1-related peptidase b1 OS=Mus musculus OX=10090 GN=Klk1b1 PE=2 SV=1
6	AFDB:Q61759	0.930	0.930	3.007E-40	261	0.590	0.590	Q61759.pdb.gz	K1B21_MOUSE Kallikrein 1-related peptidase b21 OS=Mus musculus OX=10090 GN=Klk1b21 PE=2 SV=3
7	AFDB:P36368	0.961	0.961	3.360E-40	261	0.567	0.567	P36368.pdb.gz	EGFB2_MOUSE Epidermal growth factor-binding protein type B OS=Mus musculus OX=10090 GN=Egfbp2 PE=1 SV=1
8	AFDB:A0A0G2K6G1	0.934	0.934	6.186E-40	261	0.586	0.586	A0A0G2K6G1.pdb.gz	A0A0G2K6G1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=2
9	AFDB:P15949	0.944	0.944	1.019E-39	261	0.582	0.582	P15949.pdb.gz	K1KB9_MOUSE Kallikrein 1-related peptidase b9 OS=Mus musculus OX=10090 GN=Klk1b9 PE=2 SV=1
10	AFDB:P15945	0.938	0.938	1.422E-39	261	0.586	0.586	P15945.pdb.gz	K1KB5_MOUSE Kallikrein 1-related peptidase b5 OS=Mus musculus OX=10090 GN=Klk1b5 PE=2 SV=1
11	AFDB:G3V8H1	0.924	0.924	1.983E-39	261	0.582	0.582	G3V8H1.pdb.gz	G3V8H1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=1
12	PDB:1spjA	0.887	0.980	2.151E-36	236	0.594	0.657	1spjA.pdb.gz	1.70 A X-ray structure of human apo kallikrein 1: Structural changes upon peptide inhibitor/substrate binding
13	PDB:3qumP	0.828	0.908	2.540E-34	237	0.720	0.793	3qumP.pdb.gz	Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
14	PDB:1ao5A	0.889	0.982	2.685E-34	236	0.521	0.576	1ao5A.pdb.gz
15	PDB:1tonA	0.822	0.940	1.770E-31	227	0.506	0.581	1tonA.pdb.gz	Rat submaxillary gland serine protease, tonin. Structure solution and refinement at 1.8 A resolution.
16	PDB:2ra3A	0.831	0.966	4.805E-29	224	0.406	0.473	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
17	PDB:5ms3A	0.846	0.966	1.104E-28	228	0.402	0.461	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
18	PDB:1npmA	0.816	0.952	1.721E-28	223	0.421	0.493	1npmA.pdb.gz
19	PDB:2a31A	0.829	0.967	7.284E-28	223	0.395	0.462	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
20	PDB:6qfgA	0.805	0.938	1.977E-27	223	0.398	0.466	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20151	0.0	536	261	1.000	1.000	KLK2_HUMAN Kallikrein-2 OS=Homo sapiens OX=9606 GN=KLK2 PE=1 SV=1
2	P07288	3.63e-149	419	261	0.770	0.770	KLK3_HUMAN Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2
3	P06870	3.50e-124	355	262	0.659	0.656	KLK1_HUMAN Kallikrein-1 OS=Homo sapiens OX=9606 GN=KLK1 PE=1 SV=2
4	P00755	1.22e-112	326	261	0.598	0.598	K1KB1_MOUSE Kallikrein 1-related peptidase b1 OS=Mus musculus OX=10090 GN=Klk1b1 PE=2 SV=1
5	P15945	5.45e-110	319	261	0.586	0.586	K1KB5_MOUSE Kallikrein 1-related peptidase b5 OS=Mus musculus OX=10090 GN=Klk1b5 PE=2 SV=1
6	Q61759	1.27e-109	318	261	0.590	0.590	K1B21_MOUSE Kallikrein 1-related peptidase b21 OS=Mus musculus OX=10090 GN=Klk1b21 PE=2 SV=3
7	G3V8H1	4.08e-109	317	261	0.582	0.582	G3V8H1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=1
8	P15949	3.58e-106	310	261	0.582	0.582	K1KB9_MOUSE Kallikrein 1-related peptidase b9 OS=Mus musculus OX=10090 GN=Klk1b9 PE=2 SV=1
9	P36369	1.55e-105	308	261	0.579	0.579	K1B26_MOUSE Kallikrein 1-related peptidase b26 OS=Mus musculus OX=10090 GN=Klk1b26 PE=2 SV=1
10	P36368	5.51e-105	306	261	0.567	0.567	EGFB2_MOUSE Epidermal growth factor-binding protein type B OS=Mus musculus OX=10090 GN=Egfbp2 PE=1 SV=1
11	P15948	7.71e-105	306	259	0.582	0.587	K1B22_MOUSE Kallikrein 1-related peptidase b22 OS=Mus musculus OX=10090 GN=Klk1b22 PE=1 SV=1
12	P00759	2.56e-101	297	259	0.563	0.568	KLK2_RAT Tonin OS=Rattus norvegicus OX=10116 GN=Klk2 PE=1 SV=1
13	P36376	7.32e-101	296	259	0.552	0.556	KLK12_RAT Glandular kallikrein-12, submandibular/renal OS=Rattus norvegicus OX=10116 GN=Klk12 PE=2 SV=1
14	P00757	2.40e-100	295	256	0.556	0.566	K1KB4_MOUSE Kallikrein 1-related peptidase-like b4 OS=Mus musculus OX=10090 GN=Klk1b4 PE=1 SV=1
15	Q9JM71	5.89e-97	286	263	0.582	0.578	K1B27_MOUSE Kallikrein 1-related peptidase b27 OS=Mus musculus OX=10090 GN=Klk1b27 PE=1 SV=1
16	P07647	1.76e-94	280	259	0.529	0.533	KLK9_RAT Submandibular glandular kallikrein-9 OS=Rattus norvegicus OX=10116 GN=Klk9 PE=1 SV=1
17	A0A0G2K6G1	4.50e-82	248	250	0.464	0.484	A0A0G2K6G1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=2
18	Q6IE13	2.94e-73	225	230	0.479	0.543	Q6IE13_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=2 SV=1
19	Q9QYN3	1.92e-72	224	276	0.425	0.402	KLK11_MOUSE Kallikrein-11 OS=Mus musculus OX=10090 GN=Klk11 PE=2 SV=1
20	Q9UBX7	7.65e-72	223	282	0.410	0.379	KLK11_HUMAN Kallikrein-11 OS=Homo sapiens OX=9606 GN=KLK11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	0.3	22.9	Domain of unknown function (DUF1986)
2	PF00089 Trypsin	2.5e-67	238.5	Trypsin
3	PF13365 Trypsin_2	3.8e-06	39.4	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.981	Androgen receptor
2	9606.ENSP00000376793	0.941	Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
3	9606.ENSP00000370473	0.927	Insulin-like growth factor-binding protein 3
4	9606.ENSP00000333203	0.924	Plasma serine protease inhibitor
5	9606.ENSP00000361405	0.918	Matrix metalloproteinase-9
6	9606.ENSP00000302665	0.915	Insulin-like growth factor I
7	9606.ENSP00000314151	0.913	Prostate-specific antigen
8	9606.ENSP00000296417	0.912	Histone H2A.Z
9	9606.ENSP00000343325	0.910	Serine/threonine-protein kinase N1
10	9606.ENSP00000391826	0.910	Insulin-like growth factor II
11	9606.ENSP00000308405	0.909	Histone H2A.V
12	9606.ENSP00000236826	0.905	Neutrophil collagenase
13	9606.ENSP00000332194	0.903	Histone H2A type 2-C
14	9606.ENSP00000416683	0.903	Insulin-like growth factor-binding protein complex acid labile subunit
15	9606.ENSP00000349430	0.902	Histone H2B type 1-K
16	9606.ENSP00000358151	0.902	Histone H2B type 2-E
17	9606.ENSP00000481622	0.902	Histone H2B type F-S
18	9606.ENSP00000484261	0.901	Histone H2A-Bbd type 1
19	9606.ENSP00000274764	0.900	Histone H2B type 1-A
20	9606.ENSP00000289316	0.900	Histone H2B type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	0.999	serine-type endopeptidase activity
GO:0005515	0.982	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.978	biological regulation
GO:0050789	0.962	regulation of biological process
GO:0071704	0.941	organic substance metabolic process
GO:0044238	0.934	primary metabolic process
GO:0006807	0.913	nitrogen compound metabolic process
GO:1901564	0.898	organonitrogen compound metabolic process
GO:0019538	0.893	protein metabolic process
GO:0019222	0.883	regulation of metabolic process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0048518	0.849	positive regulation of biological process
GO:0002920	0.833	regulation of humoral immune response
GO:0006508	0.796	proteolysis
GO:0010468	0.785	regulation of gene expression
GO:0002697	0.783	regulation of immune effector process
GO:0002759	0.776	regulation of antimicrobial humoral response
GO:0002700	0.728	regulation of production of molecular mediator of immune response
GO:0050794	0.723	regulation of cellular process
GO:0002784	0.666	regulation of antimicrobial peptide production
GO:0009987	0.643	cellular process
GO:0050896	0.595	response to stimulus
GO:0002922	0.570	positive regulation of humoral immune response
GO:0002833	0.547	positive regulation of response to biotic stimulus
GO:0002760	0.530	positive regulation of antimicrobial humoral response
GO:1900424	0.529	regulation of defense response to bacterium
GO:0009893	0.466	positive regulation of metabolic process
GO:0010604	0.425	positive regulation of macromolecule metabolic process
GO:0002786	0.386	regulation of antibacterial peptide production
GO:0002699	0.331	positive regulation of immune effector process
GO:1900426	0.324	positive regulation of defense response to bacterium
GO:0002225	0.324	positive regulation of antimicrobial peptide production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0031982	0.996	vesicle
GO:0043230	0.980	extracellular organelle
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:1903561	0.960	extracellular vesicle
GO:0070062	0.952	extracellular exosome
GO:0005634	0.863	nucleus
GO:0005737	0.697	cytoplasm
GO:0043233	0.379	organelle lumen
GO:0070013	0.366	intracellular organelle lumen
GO:0031410	0.348	cytoplasmic vesicle
GO:0032991	0.345	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	0.999	Serine endopeptidases.

[back to server]