StarFunc result for job id P20160

User Input

>input (251 residues)
MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHAR
FVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQ
LDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC
RPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWID
GVLNNPGPGPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20160	1.000	1.000	2.266E-52	251	1.000	1.000	P20160.pdb.gz	CAP7_HUMAN Azurocidin OS=Homo sapiens OX=9606 GN=AZU1 PE=1 SV=3
2	PDB:1fy1A	0.888	0.990	2.989E-41	225	0.888	0.991	1fy1A.pdb.gz
3	AFDB:P08246	0.871	0.820	5.537E-30	267	0.450	0.423	P08246.pdb.gz	ELNE_HUMAN Neutrophil elastase OS=Homo sapiens OX=9606 GN=ELANE PE=1 SV=1
4	AFDB:Q61096	0.858	0.848	6.909E-30	254	0.446	0.441	Q61096.pdb.gz	PRTN3_MOUSE Myeloblastin OS=Mus musculus OX=10090 GN=Prtn3 PE=1 SV=2
5	AFDB:Q86SR2	0.618	0.685	9.298E-29	226	0.717	0.796	Q86SR2.pdb.gz	Q86SR2_HUMAN AZU1 protein (Fragment) OS=Homo sapiens OX=9606 GN=AZU1 PE=2 SV=1
6	PDB:5a09A	0.826	0.948	2.123E-28	218	0.406	0.468	5a09A.pdb.gz	Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
7	AFDB:D4A488	0.857	0.795	2.253E-28	271	0.418	0.387	D4A488.pdb.gz	D4A488_RAT Elastase, neutrophil expressed OS=Rattus norvegicus OX=10116 GN=Elane PE=4 SV=1
8	AFDB:P24158	0.851	0.835	3.507E-28	256	0.394	0.387	P24158.pdb.gz	PRTN3_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=3
9	PDB:1fujA	0.834	0.945	8.009E-28	221	0.394	0.448	1fujA.pdb.gz	The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.
10	AFDB:P51124	0.837	0.818	2.585E-24	257	0.363	0.354	P51124.pdb.gz	GRAM_HUMAN Granzyme M OS=Homo sapiens OX=9606 GN=GZMM PE=1 SV=2
11	AFDB:Q6UWY2	0.851	0.757	5.019E-24	283	0.371	0.329	Q6UWY2.pdb.gz	PRS57_HUMAN Serine protease 57 OS=Homo sapiens OX=9606 GN=PRSS57 PE=1 SV=2
12	PDB:4q7xA	0.839	0.894	1.784E-23	235	0.347	0.370	4q7xA.pdb.gz
13	AFDB:P00746	0.810	0.804	2.411E-22	253	0.339	0.336	P00746.pdb.gz	CFAD_HUMAN Complement factor D OS=Homo sapiens OX=9606 GN=CFD PE=1 SV=5
14	AFDB:P49864	0.779	0.759	2.411E-22	258	0.367	0.357	P49864.pdb.gz	GRAK_RAT Granzyme K OS=Rattus norvegicus OX=10116 GN=Gzmk PE=1 SV=1
15	PDB:2zghA	0.819	0.888	2.835E-22	231	0.339	0.368	2zghA.pdb.gz	Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
16	PDB:5mt0A	0.791	0.861	3.610E-21	230	0.307	0.335	5mt0A.pdb.gz	Structure-Based Library Design and Fragment Screening for the Identification of Reversible Complement Factor D Protease Inhibitors.
17	PDB:1kynB	0.791	0.879	7.831E-21	225	0.315	0.351	1kynB.pdb.gz	Nonpeptide inhibitors of cathepsin G: optimization of a novel beta-ketophosphonic acid lead by structure-based drug design.
18	PDB:1mzaA	0.782	0.816	1.699E-20	240	0.335	0.350	1mzaA.pdb.gz
19	PDB:2ra3A	0.787	0.878	2.240E-20	224	0.275	0.308	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
20	PDB:2a7jA	0.794	0.829	2.367E-20	240	0.283	0.296	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20160	0.0	506	251	1.000	1.000	CAP7_HUMAN Azurocidin OS=Homo sapiens OX=9606 GN=AZU1 PE=1 SV=3
2	Q86SR2	2.00e-127	362	226	0.713	0.792	Q86SR2_HUMAN AZU1 protein (Fragment) OS=Homo sapiens OX=9606 GN=AZU1 PE=2 SV=1
3	A0A087WXP0	2.67e-94	275	150	0.542	0.907	A0A087WXP0_HUMAN Azurocidin OS=Homo sapiens OX=9606 GN=AZU1 PE=1 SV=1
4	Q61096	6.76e-64	201	254	0.442	0.437	PRTN3_MOUSE Myeloblastin OS=Mus musculus OX=10090 GN=Prtn3 PE=1 SV=2
5	P08246	5.79e-58	187	267	0.442	0.416	ELNE_HUMAN Neutrophil elastase OS=Homo sapiens OX=9606 GN=ELANE PE=1 SV=1
6	P24158	8.28e-58	186	256	0.394	0.387	PRTN3_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=3
7	Q3UP87	2.44e-56	182	265	0.410	0.389	ELNE_MOUSE Neutrophil elastase OS=Mus musculus OX=10090 GN=Elane PE=1 SV=1
8	D4A488	1.45e-54	178	271	0.398	0.369	D4A488_RAT Elastase, neutrophil expressed OS=Rattus norvegicus OX=10116 GN=Elane PE=4 SV=1
9	U3KPS2	1.33e-51	169	215	0.367	0.428	U3KPS2_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=1
10	Q58J84	2.46e-37	133	256	0.299	0.293	Q58J84_ICTPU Granzyme-like I OS=Ictalurus punctatus OX=7998 GN=LOC100304650 PE=2 SV=1
11	P00746	6.23e-36	130	253	0.343	0.340	CFAD_HUMAN Complement factor D OS=Homo sapiens OX=9606 GN=CFD PE=1 SV=5
12	P11034	7.75e-36	129	246	0.307	0.313	MCPT1_MOUSE Mast cell protease 1 OS=Mus musculus OX=10090 GN=Mcpt1 PE=1 SV=2
13	Q6UWY2	1.67e-35	129	283	0.359	0.318	PRS57_HUMAN Serine protease 57 OS=Homo sapiens OX=9606 GN=PRSS57 PE=1 SV=2
14	P97592	8.72e-35	126	246	0.319	0.325	MCPT4_RAT Mast cell protease 4 OS=Rattus norvegicus OX=10116 GN=Mcpt4 PE=2 SV=1
15	P49864	9.56e-35	127	258	0.347	0.337	GRAK_RAT Granzyme K OS=Rattus norvegicus OX=10116 GN=Gzmk PE=1 SV=1
16	P12544	1.02e-34	127	262	0.335	0.321	GRAA_HUMAN Granzyme A OS=Homo sapiens OX=9606 GN=GZMA PE=1 SV=2
17	P04187	1.13e-34	126	247	0.303	0.308	GRAB_MOUSE Granzyme B(G,H) OS=Mus musculus OX=10090 GN=Gzmb PE=1 SV=1
18	P03953	1.29e-34	126	259	0.319	0.309	CFAD_MOUSE Complement factor D OS=Mus musculus OX=10090 GN=Cfd PE=1 SV=1
19	P21812	1.41e-34	126	246	0.299	0.305	MCPT4_MOUSE Mast cell protease 4 OS=Mus musculus OX=10090 GN=Mcpt4 PE=1 SV=1
20	P18291	2.24e-34	125	248	0.299	0.302	GRAB_RAT Granzyme B OS=Rattus norvegicus OX=10116 GN=Gzmb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	7.5	18.4	Domain of unknown function (DUF1986)
2	PF00089 Trypsin	3.7e-46	169.3	Trypsin
3	PF06427 UDP-g_GGTase	5.5e+02	12.1	UDP-glucose:Glycoprotein Glucosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225275	0.940	Myeloperoxidase
2	9606.ENSP00000369981	0.839	Endophilin-A1
3	9606.ENSP00000262865	0.811	Bactericidal permeability-increasing protein
4	9606.ENSP00000466090	0.801	Neutrophil elastase
5	9606.ENSP00000297435	0.788	Neutrophil defensin 4
6	9606.ENSP00000234347	0.674	Myeloblastin
7	9606.ENSP00000269886	0.674	Endophilin-A2
8	9606.ENSP00000450838	0.660	Kallistatin
9	9606.ENSP00000216336	0.659	Cathepsin G
10	9606.ENSP00000296435	0.657	Cathelicidin antimicrobial peptide
11	9606.ENSP00000341170	0.641	Pleiotrophin
12	9606.ENSP00000357754	0.605	Sperm mitochondrial-associated cysteine-rich protein
13	9606.ENSP00000374265	0.605	Glutathione peroxidase 2
14	9606.ENSP00000420939	0.603	Selenoprotein P
15	9606.ENSP00000263816	0.597	Low-density lipoprotein receptor-related protein 2
16	9606.ENSP00000302324	0.580	Eosinophil cationic protein
17	9606.ENSP00000357189	0.572	Hepatoma-derived growth factor
18	9606.ENSP00000264498	0.562	Fibroblast growth factor 2
19	9606.ENSP00000320866	0.551	Calreticulin
20	9606.ENSP00000385451	0.540	Midkine

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017171	1.000	serine hydrolase activity
GO:0008233	1.000	peptidase activity
GO:0008201	0.999	heparin binding
GO:0005515	0.997	protein binding
GO:0008236	0.990	serine-type peptidase activity
GO:0004252	0.925	serine-type endopeptidase activity
GO:0043394	0.839	proteoglycan binding
GO:0043395	0.736	heparan sulfate proteoglycan binding
GO:0005102	0.339	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0065007	0.989	biological regulation
GO:0002376	0.989	immune system process
GO:0044419	0.988	biological process involved in interspecies interaction between organisms
GO:0050789	0.979	regulation of biological process
GO:0050794	0.967	regulation of cellular process
GO:0009987	0.947	cellular process
GO:0048518	0.941	positive regulation of biological process
GO:0019222	0.940	regulation of metabolic process
GO:0043207	0.925	response to external biotic stimulus
GO:0006955	0.919	immune response
GO:0006950	0.906	response to stress
GO:0006959	0.904	humoral immune response
GO:0051707	0.901	response to other organism
GO:0032501	0.885	multicellular organismal process
GO:0001906	0.866	cell killing
GO:0008152	0.845	metabolic process
GO:0051716	0.842	cellular response to stimulus
GO:0060255	0.825	regulation of macromolecule metabolic process
GO:0080090	0.814	regulation of primary metabolic process
GO:0001817	0.783	regulation of cytokine production
GO:1903555	0.766	regulation of tumor necrosis factor superfamily cytokine production
GO:0001819	0.762	positive regulation of cytokine production
GO:0006952	0.761	defense response
GO:0042221	0.749	response to chemical
GO:0051171	0.747	regulation of nitrogen compound metabolic process
GO:0048522	0.740	positive regulation of cellular process
GO:0048519	0.736	negative regulation of biological process
GO:0051702	0.732	biological process involved in interaction with symbiont
GO:0016477	0.720	cell migration
GO:0009617	0.716	response to bacterium
GO:0048583	0.714	regulation of response to stimulus
GO:0071704	0.699	organic substance metabolic process
GO:0098542	0.688	defense response to other organism
GO:0048584	0.676	positive regulation of response to stimulus
GO:0002682	0.673	regulation of immune system process
GO:0031323	0.671	regulation of cellular metabolic process
GO:0051873	0.656	killing by host of symbiont cells
GO:0002252	0.645	immune effector process
GO:0065009	0.636	regulation of molecular function
GO:1903557	0.630	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0002444	0.595	myeloid leukocyte mediated immunity
GO:0019730	0.594	antimicrobial humoral response
GO:0044238	0.590	primary metabolic process
GO:0023052	0.572	signaling
GO:0048856	0.563	anatomical structure development
GO:0001909	0.560	leukocyte mediated cytotoxicity
GO:0006954	0.555	inflammatory response
GO:0032680	0.552	regulation of tumor necrosis factor production
GO:0007154	0.549	cell communication
GO:0007275	0.516	multicellular organism development
GO:0006807	0.495	nitrogen compound metabolic process
GO:0007165	0.475	signal transduction
GO:0032652	0.471	regulation of interleukin-1 production
GO:0032760	0.459	positive regulation of tumor necrosis factor production
GO:0051246	0.449	regulation of protein metabolic process
GO:0043170	0.443	macromolecule metabolic process
GO:0042742	0.437	defense response to bacterium
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0031325	0.404	positive regulation of cellular metabolic process
GO:1901564	0.369	organonitrogen compound metabolic process
GO:0048523	0.365	negative regulation of cellular process
GO:0019538	0.347	protein metabolic process
GO:0010646	0.332	regulation of cell communication
GO:0050790	0.329	regulation of catalytic activity
GO:0010033	0.323	response to organic substance
GO:0001932	0.316	regulation of protein phosphorylation
GO:0009889	0.311	regulation of biosynthetic process
GO:0023051	0.307	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0012505	0.995	endomembrane system
GO:0030141	0.986	secretory granule
GO:0034774	0.979	secretory granule lumen
GO:0005764	0.978	lysosome
GO:0016020	0.964	membrane
GO:0070062	0.956	extracellular exosome
GO:0042582	0.899	azurophil granule
GO:0005775	0.778	vacuolar lumen
GO:0035578	0.752	azurophil granule lumen
GO:0062023	0.504	collagen-containing extracellular matrix
GO:0031090	0.485	organelle membrane
GO:0098588	0.352	bounding membrane of organelle
GO:0005886	0.349	plasma membrane
GO:0030659	0.338	cytoplasmic vesicle membrane
GO:0032991	0.331	protein-containing complex
GO:0005829	0.322	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.925	Serine endopeptidases.

[back to server]