StarFunc result for job id P20226

User Input

>input (339 residues)
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQ
LFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDL
KTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20226	1.000	1.000	2.062E-50	339	1.000	1.000	P20226.pdb.gz	TBP_HUMAN TATA-box-binding protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=2
2	AFDB:P53360	0.572	0.609	7.947E-49	318	0.914	0.975	P53360.pdb.gz	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
3	AFDB:P27633	0.580	0.659	5.686E-46	297	0.820	0.936	P27633.pdb.gz	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
4	AFDB:Q28DH2	0.561	0.591	2.608E-36	322	0.587	0.618	Q28DH2.pdb.gz	TBPL2_XENTR TATA box-binding protein-like 2 OS=Xenopus tropicalis OX=8364 GN=tbpl2 PE=2 SV=1
5	AFDB:Q1JPY4	0.555	0.603	4.088E-36	312	0.560	0.609	Q1JPY4.pdb.gz	TBPL2_DANRE TATA box-binding protein-like 2 OS=Danio rerio OX=7955 GN=tbpl2 PE=1 SV=1
6	AFDB:Q6SJ96	0.567	0.513	1.124E-35	375	0.572	0.517	Q6SJ96.pdb.gz	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
7	AFDB:P20227	0.551	0.530	1.971E-35	353	0.558	0.535	P20227.pdb.gz	TBP_DROME TATA-box-binding protein OS=Drosophila melanogaster OX=7227 GN=Tbp PE=1 SV=1
8	AFDB:P32085	0.556	0.554	7.601E-33	340	0.522	0.521	P32085.pdb.gz	TBP_CAEEL TATA-box-binding protein OS=Caenorhabditis elegans OX=6239 GN=tbp-1 PE=1 SV=1
9	AFDB:P13393	0.548	0.773	1.669E-32	240	0.442	0.625	P13393.pdb.gz	TBP_YEAST TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT15 PE=1 SV=3
10	AFDB:Q6SJ95	0.572	0.554	2.089E-32	350	0.478	0.463	Q6SJ95.pdb.gz	TBPL2_MOUSE TATA box-binding protein-like 2 OS=Mus musculus OX=10090 GN=Tbpl2 PE=1 SV=1
11	PDB:5iy6P	0.535	0.970	4.625E-31	185	0.546	1.000	5iy6P.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
12	PDB:1vokA	0.527	0.921	3.911E-30	192	0.442	0.781	1vokA.pdb.gz
13	PDB:7o4iO	0.530	0.989	3.307E-29	181	0.428	0.801	7o4iO.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:3ociB	0.516	0.964	2.798E-27	180	0.392	0.739	3ociB.pdb.gz
15	PDB:4pabB	0.259	0.131	6.990E-4	824	0.053	0.022	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
16	PDB:1wsvA	0.246	0.231	2.032E-3	371	0.044	0.040	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
17	PDB:1vloA	0.216	0.205	3.565E-3	364	0.032	0.030	1vloA.pdb.gz
18	PDB:2f1fA	0.153	0.240	1.096E-2	163	0.062	0.129	2f1fA.pdb.gz
19	PDB:2hzsD	0.101	0.135	1.718E-2	214	0.077	0.121	2hzsD.pdb.gz	Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
20	PDB:2j0wA	0.174	0.147	2.151E-2	447	0.053	0.040	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y1F6	0.0	561	293	0.838	0.969	A0A8I5Y1F6_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
2	A0A8I5ZNX4	0.0	514	330	0.838	0.861	A0A8I5ZNX4_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
3	A0A8I6A9T0	0.0	563	400	0.841	0.713	A0A8I6A9T0_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
4	P20226	0.0	674	339	1.000	1.000	TBP_HUMAN TATA-box-binding protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=2
5	P27633	0.0	516	297	0.808	0.923	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
6	P29037	0.0	613	316	0.912	0.978	TBP_MOUSE TATA-box-binding protein OS=Mus musculus OX=10090 GN=Tbp PE=1 SV=1
7	P53360	0.0	617	318	0.914	0.975	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
8	Q28GG8	0.0	524	297	0.820	0.936	TBP_XENTR TATA-box-binding protein OS=Xenopus tropicalis OX=8364 GN=tbp PE=2 SV=1
9	Q32MN6	0.0	569	288	0.850	1.000	Q32MN6_HUMAN TBP protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=1
10	Q66HB1	0.0	616	318	0.914	0.975	Q66HB1_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=3 SV=1
11	Q7SXL3	0.0	518	302	0.805	0.904	TBP_DANRE TATA-box-binding protein OS=Danio rerio OX=7955 GN=tbp PE=1 SV=1
12	A0A8I6AFF5	1.74e-142	405	262	0.729	0.943	A0A8I6AFF5_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=3 SV=1
13	Q7Z6S5	2.78e-139	395	208	0.614	1.000	Q7Z6S5_HUMAN TATA-box binding protein (Fragment) OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=1
14	Q6SJ96	2.22e-133	386	375	0.605	0.547	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
15	Q5UE94	8.50e-131	377	320	0.619	0.656	TBPL2_XENLA TATA box-binding protein-like 2 OS=Xenopus laevis OX=8355 GN=tbpl2 PE=2 SV=1
16	Q28DH2	1.08e-128	372	322	0.516	0.543	TBPL2_XENTR TATA box-binding protein-like 2 OS=Xenopus tropicalis OX=8364 GN=tbpl2 PE=2 SV=1
17	Q1JPY4	6.94e-127	367	312	0.507	0.551	TBPL2_DANRE TATA box-binding protein-like 2 OS=Danio rerio OX=7955 GN=tbpl2 PE=1 SV=1
18	P20227	9.25e-125	363	353	0.501	0.482	TBP_DROME TATA-box-binding protein OS=Drosophila melanogaster OX=7227 GN=Tbp PE=1 SV=1
19	Q8W0W4	3.55e-112	326	203	0.451	0.754	TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP2 PE=1 SV=2
20	Q6SJ95	1.90e-111	330	350	0.501	0.486	TBPL2_MOUSE TATA box-binding protein-like 2 OS=Mus musculus OX=10090 GN=Tbpl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12679 ABC2_membrane_2	16	16.2	ABC-2 family transporter protein
2	PF04684 BAF1_ABF1	1.1e+02	13.3	BAF1 / ABF1 chromatin reorganising factor
3	PF10561 C2orf69	15	16.3	C2orf69
4	PF03552 Cellulose_synt	2e+02	11.9	Cellulose synthase
5	PF02862 DDHD	0.22	23.1	DDHD domain
6	PF07394 DUF1501	8.3e+02	10.5	Protein of unknown function (DUF1501)
7	PF15928 DUF4746	5.7	17.9	Domain of unknown function (DUF4746)
8	PF10513 EPL1	0.39	22.7	Enhancer of polycomb-like
9	PF08505 MMR1	1.3e+02	14.2	Mitochondrial Myo2 receptor-related protein
10	PF03189 Otopetrin	1.7e+02	12.5	Otopetrin
11	PF09770 PAT1	2.5e+02	11.4	Topoisomerase II-associated protein PAT1
12	PF01080 Presenilin	1.3e+02	12.8	Presenilin
13	PF07454 SpoIIP	88	14.0	Stage II sporulation protein P (SpoIIP)
14	PF00352 TBP	7.5e-63	219.7	Transcription factor TFIID (or TATA-binding protein, TBP)
15	PF03153 TFIIA	1.3e+02	14.0	Transcription factor IIA, alpha/beta subunit
16	PF11711 Tim54	9.4e+02	9.9	Inner membrane protein import complex subunit Tim54
17	PF20175 Tra1_central	57	13.8	Tra1 HEAT repeat central region
18	PF09676 TraV	8.7e+02	12.4	Type IV conjugative transfer system lipoprotein (TraV)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000265990	0.999	TATA-binding protein-associated factor 172
4	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
5	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
6	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
7	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
8	9606.ENSP00000351575	0.999	Transcription factor TFIIIB component B'' homolog
9	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
10	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
11	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
12	9606.ENSP00000359531	0.999	Transcription initiation factor IIB
13	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
14	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
15	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
16	9606.ENSP00000379372	0.999	Transcription initiation factor IIA subunit 2
17	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
18	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
19	9606.ENSP00000418379	0.999	Transcription initiation factor TFIID subunit 1-like
20	9606.ENSP00000428426	0.999	Transcription elongation factor A protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0061629	0.999	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001091	0.999	RNA polymerase II general transcription initiation factor binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000979	0.988	RNA polymerase II core promoter sequence-specific DNA binding
GO:0019899	0.970	enzyme binding
GO:0000995	0.967	RNA polymerase III general transcription initiation factor activity
GO:0005102	0.945	signaling receptor binding
GO:0001093	0.432	TFIIB-class transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0048518	0.993	positive regulation of biological process
GO:0043170	0.993	macromolecule metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0051252	0.987	regulation of RNA metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0048522	0.982	positive regulation of cellular process
GO:0006139	0.980	nucleobase-containing compound metabolic process
GO:0010467	0.979	gene expression
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0090304	0.973	nucleic acid metabolic process
GO:0044271	0.971	cellular nitrogen compound biosynthetic process
GO:0051173	0.970	positive regulation of nitrogen compound metabolic process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0016070	0.962	RNA metabolic process
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0010557	0.955	positive regulation of macromolecule biosynthetic process
GO:0006351	0.950	DNA-templated transcription
GO:0045935	0.949	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.939	positive regulation of RNA biosynthetic process
GO:0006366	0.933	transcription by RNA polymerase II
GO:0006383	0.930	transcription by RNA polymerase III
GO:0045893	0.926	positive regulation of DNA-templated transcription
GO:0006352	0.834	DNA-templated transcription initiation
GO:0006357	0.802	regulation of transcription by RNA polymerase II
GO:0071840	0.788	cellular component organization or biogenesis
GO:0045944	0.785	positive regulation of transcription by RNA polymerase II
GO:0006367	0.780	transcription initiation at RNA polymerase II promoter
GO:0016043	0.778	cellular component organization
GO:0071824	0.740	protein-DNA complex subunit organization
GO:0065004	0.686	protein-DNA complex assembly
GO:0070897	0.632	transcription preinitiation complex assembly
GO:2000142	0.619	regulation of DNA-templated transcription initiation
GO:2000144	0.562	positive regulation of DNA-templated transcription initiation
GO:0051123	0.545	RNA polymerase II preinitiation complex assembly
GO:0060260	0.510	regulation of transcription initiation by RNA polymerase II
GO:1901564	0.456	organonitrogen compound metabolic process
GO:0060261	0.447	positive regulation of transcription initiation by RNA polymerase II
GO:0019538	0.346	protein metabolic process
GO:0032501	0.315	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005667	1.000	transcription regulator complex
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0140535	0.995	intracellular protein-containing complex
GO:1990234	0.995	transferase complex
GO:0090575	0.991	RNA polymerase II transcription regulator complex
GO:0061695	0.988	transferase complex, transferring phosphorus-containing groups
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0055029	0.977	nuclear DNA-directed RNA polymerase complex
GO:0005669	0.968	transcription factor TFIID complex
GO:0005694	0.853	chromosome
GO:0000785	0.736	chromatin
GO:0005829	0.615	cytosol
GO:0000791	0.474	euchromatin
GO:0032993	0.355	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]