StarFunc result for job id P20248

User Input

>input (432 residues)
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20248	1.000	1.000	4.303E-53	432	1.000	1.000	P20248.pdb.gz	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
2	AFDB:Q6NV43	0.630	0.636	7.444E-35	428	0.588	0.593	Q6NV43.pdb.gz	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
3	AFDB:A0A2R8Q5W9	0.613	0.584	3.662E-31	454	0.593	0.564	A0A2R8Q5W9.pdb.gz
4	PDB:7b5lY	0.579	0.983	1.282E-27	253	0.583	0.996	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
5	AFDB:P14785	0.597	0.527	1.227E-21	491	0.384	0.338	P14785.pdb.gz	CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster OX=7227 GN=CycA PE=1 SV=3
6	AFDB:Q39070	0.551	0.554	1.218E-20	429	0.287	0.289	Q39070.pdb.gz	CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-2 PE=1 SV=2
7	AFDB:P24860	0.570	0.573	6.390E-20	430	0.299	0.300	P24860.pdb.gz	CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus OX=10090 GN=Ccnb1 PE=1 SV=3
8	AFDB:Q9C6Y3	0.567	0.533	6.619E-19	460	0.317	0.298	Q9C6Y3.pdb.gz	CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-1 PE=1 SV=1
9	AFDB:Q9C6A9	0.576	0.667	6.906E-19	372	0.301	0.349	Q9C6A9.pdb.gz	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
10	AFDB:Q9LDM4	0.563	0.567	1.102E-18	429	0.250	0.252	Q9LDM4.pdb.gz	CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-3 PE=2 SV=2
11	AFDB:Q39067	0.569	0.552	1.150E-18	445	0.278	0.270	Q39067.pdb.gz	CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-2 PE=1 SV=2
12	PDB:7nj0C	0.552	0.874	3.231E-14	270	0.215	0.344	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
13	PDB:2w96A	0.486	0.816	3.441E-11	249	0.157	0.273	2w96A.pdb.gz
14	PDB:3g33B	0.471	0.867	1.523E-10	229	0.157	0.297	3g33B.pdb.gz
15	PDB:1g3nC	0.448	0.806	1.115E-8	233	0.116	0.215	1g3nC.pdb.gz
16	PDB:6gzhB	0.418	0.686	6.276E-6	252	0.109	0.187	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
17	PDB:7jv7B	0.401	0.541	5.256E-5	310	0.088	0.123	7jv7B.pdb.gz
18	PDB:5hbhB	0.385	0.590	6.501E-5	270	0.104	0.167	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
19	PDB:7kpvB	0.393	0.562	1.038E-4	290	0.118	0.176	7kpvB.pdb.gz
20	PDB:1zp2A	0.367	0.655	2.137E-4	227	0.076	0.145	1zp2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVY9	0.0	750	418	0.863	0.892	A0A0G2JVY9_RAT Cyclin-A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=3 SV=2
2	A0JPK0	0.0	555	338	0.613	0.784	A0JPK0_RAT Ccna2 protein OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=2 SV=1
3	G3V802	0.0	557	380	0.613	0.697	G3V802_RAT Cyclin A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=1 SV=2
4	P20248	0.0	892	432	1.000	1.000	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
5	P30274	0.0	813	430	0.900	0.905	CCNA2_BOVIN Cyclin-A2 OS=Bos taurus OX=9913 GN=CCNA2 PE=1 SV=2
6	P43449	0.0	534	395	0.639	0.699	CCNA2_CHICK Cyclin-A2 OS=Gallus gallus OX=9031 GN=CCNA2 PE=1 SV=1
7	P51943	0.0	740	422	0.850	0.870	CCNA2_MOUSE Cyclin-A2 OS=Mus musculus OX=10090 GN=Ccna2 PE=1 SV=2
8	Q98TA3	1.76e-169	484	428	0.597	0.603	Q98TA3_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=CycA2 PE=2 SV=1
9	Q6NV43	2.12e-169	483	428	0.597	0.603	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
10	Q91ZX8	1.24e-154	440	265	0.521	0.849	Q91ZX8_RAT Cyclin-A2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=2 SV=1
11	P78396	4.50e-120	359	465	0.440	0.409	CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens OX=9606 GN=CCNA1 PE=1 SV=1
12	Q61456	1.18e-116	349	421	0.426	0.437	CCNA1_MOUSE Cyclin-A1 OS=Mus musculus OX=10090 GN=Ccna1 PE=1 SV=2
13	P14785	1.31e-77	251	491	0.377	0.332	CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster OX=7227 GN=CycA PE=1 SV=3
14	Q9FMH5	1.22e-63	210	355	0.262	0.318	CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-1 PE=3 SV=1
15	Q9C6A9	1.30e-60	203	372	0.262	0.304	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
16	Q3ECW2	1.16e-57	195	370	0.257	0.300	CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-4 PE=1 SV=1
17	Q9C6Y3	3.05e-57	197	460	0.252	0.237	CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-1 PE=1 SV=1
18	Q38819	2.68e-55	191	450	0.345	0.331	CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-3 PE=1 SV=2
19	A0MEB5	3.21e-55	187	327	0.255	0.336	CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-3 PE=2 SV=2
20	Q9C968	2.22e-54	189	461	0.285	0.267	CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	1.5e-23	94.6	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	2.4e-45	164.8	Cyclin, N-terminal domain
3	PF16500 Cyclin_N2	7.2e-18	76.9	Cyclin-A N-terminal APC/C binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000209728	0.999	Cell division control protein 6 homolog
2	9606.ENSP00000228872	0.999	Cyclin-dependent kinase inhibitor 1B
3	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
4	9606.ENSP00000274255	0.999	S-phase kinase-associated protein 2
5	9606.ENSP00000301019	0.999	DNA replication factor Cdt1
6	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
7	9606.ENSP00000362768	0.999	Retinoblastoma-like protein 1
8	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
9	9606.ENSP00000384849	0.999	Cyclin-dependent kinase inhibitor 1
10	9606.ENSP00000345571	0.998	Transcription factor E2F1
11	9606.ENSP00000257904	0.997	Cyclin-dependent kinase 4
12	9606.ENSP00000296509	0.997	Mitotic spindle assembly checkpoint protein MAD2A
13	9606.ENSP00000311083	0.997	Cyclin-dependent kinases regulatory subunit 1
14	9606.ENSP00000360623	0.997	Origin recognition complex subunit 1
15	9606.ENSP00000256442	0.996	G2/mitotic-specific cyclin-B1
16	9606.ENSP00000265056	0.996	DNA replication licensing factor MCM2
17	9606.ENSP00000267163	0.996	Retinoblastoma-associated protein
18	9606.ENSP00000364976	0.996	Cyclin-dependent kinases regulatory subunit 2
19	9606.ENSP00000216122	0.995	DNA replication licensing factor MCM5
20	9606.ENSP00000269305	0.995	Cellular tumor antigen p53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	0.999	kinase binding
GO:0016538	0.990	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901	0.971	protein kinase binding
GO:0019904	0.387	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.977	primary metabolic process
GO:0048522	0.975	positive regulation of cellular process
GO:0051716	0.969	cellular response to stimulus
GO:0044237	0.968	cellular metabolic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0019222	0.965	regulation of metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0043170	0.935	macromolecule metabolic process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0048856	0.874	anatomical structure development
GO:0080090	0.826	regulation of primary metabolic process
GO:0006725	0.812	cellular aromatic compound metabolic process
GO:0071495	0.803	cellular response to endogenous stimulus
GO:0033554	0.795	cellular response to stress
GO:0007049	0.789	cell cycle
GO:1901564	0.780	organonitrogen compound metabolic process
GO:0019538	0.768	protein metabolic process
GO:0022402	0.743	cell cycle process
GO:0019219	0.735	regulation of nucleobase-containing compound metabolic process
GO:0043412	0.725	macromolecule modification
GO:0036211	0.719	protein modification process
GO:0034641	0.688	cellular nitrogen compound metabolic process
GO:0042221	0.684	response to chemical
GO:0009893	0.670	positive regulation of metabolic process
GO:0000278	0.636	mitotic cell cycle
GO:1903047	0.628	mitotic cell cycle process
GO:0070887	0.620	cellular response to chemical stimulus
GO:0007154	0.600	cell communication
GO:0051173	0.550	positive regulation of nitrogen compound metabolic process
GO:0010604	0.544	positive regulation of macromolecule metabolic process
GO:0051052	0.544	regulation of DNA metabolic process
GO:0031325	0.540	positive regulation of cellular metabolic process
GO:0023052	0.513	signaling
GO:0046483	0.468	heterocycle metabolic process
GO:0007165	0.457	signal transduction
GO:0010556	0.447	regulation of macromolecule biosynthetic process
GO:0031326	0.446	regulation of cellular biosynthetic process
GO:0010468	0.440	regulation of gene expression
GO:0044770	0.401	cell cycle phase transition
GO:0071840	0.397	cellular component organization or biogenesis
GO:0016043	0.367	cellular component organization
GO:0035556	0.341	intracellular signal transduction
GO:1901360	0.339	organic cyclic compound metabolic process
GO:0006139	0.334	nucleobase-containing compound metabolic process
GO:0090304	0.324	nucleic acid metabolic process
GO:0051726	0.320	regulation of cell cycle
GO:0051252	0.319	regulation of RNA metabolic process
GO:0042127	0.309	regulation of cell population proliferation
GO:2001141	0.301	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0032991	0.982	protein-containing complex
GO:0005829	0.969	cytosol
GO:1902494	0.857	catalytic complex
GO:1990234	0.745	transferase complex
GO:0061695	0.738	transferase complex, transferring phosphorus-containing groups
GO:0043232	0.719	intracellular non-membrane-bounded organelle
GO:1902911	0.582	protein kinase complex
GO:1902554	0.550	serine/threonine protein kinase complex
GO:0000307	0.539	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]