StarFunc result for job id P20264

User Input

>input (500 residues)
MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTS
GAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASS
PWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPH
QGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGP
GGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGG
AGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTI
CRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQ
VGTVSADTPPPHHGLQTSVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20264	1.000	1.000	4.602E-63	500	1.000	1.000	P20264.pdb.gz	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
2	AFDB:P31367	0.304	0.252	2.603E-11	610	0.218	0.179	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
3	AFDB:A0A0B4JD55	0.231	0.098	4.794E-10	1292	0.240	0.093	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
4	PDB:6t90K	0.132	0.887	7.936E-7	73	0.104	0.712	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
5	AFDB:O60422	0.205	0.207	7.620E-6	494	0.234	0.237	O60422.pdb.gz	ONEC3_HUMAN One cut domain family member 3 OS=Homo sapiens OX=9606 GN=ONECUT3 PE=1 SV=2
6	AFDB:Q9NJB5	0.191	0.105	2.301E-4	1081	0.188	0.087	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
7	PDB:4egcA	0.106	0.100	8.587E-3	539	0.068	0.063	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
8	AFDB:A0A0G2JT82	0.135	0.167	9.148E-3	399	0.158	0.198	A0A0G2JT82.pdb.gz	A0A0G2JT82_RAT Homeobox protein engrailed-like OS=Rattus norvegicus OX=10116 GN=En1 PE=3 SV=2
9	AFDB:Q38B13	0.093	0.068	1.272E-2	756	0.172	0.114	Q38B13.pdb.gz	Q38B13_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0990 PE=4 SV=1
10	AFDB:P10105	0.121	0.096	2.600E-2	635	0.176	0.139	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
11	AFDB:P82976	0.123	0.146	3.819E-2	418	0.164	0.196	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
12	AFDB:Q6DRG7	0.065	0.041	1.085E-1	1049	0.132	0.063	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
13	PDB:5iplF	0.090	0.117	1.497E-1	277	0.056	0.101	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
14	PDB:2hi3A	0.105	0.569	5.914E-1	73	0.028	0.192	2hi3A.pdb.gz
15	PDB:7f0rF	0.086	0.138	6.249E-1	278	0.058	0.104	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
16	PDB:3g46A	0.057	0.152	8.690E-1	146	0.052	0.178	3g46A.pdb.gz	Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
17	PDB:7fbyA	0.085	0.239	1.208	153	0.022	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
18	PDB:5iy6M	0.085	0.145	1.681	260	0.058	0.112	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
19	PDB:7tbhA	0.066	0.119	1.982	243	0.044	0.091	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
20	PDB:7ml4M	0.096	0.185	2.094	234	0.042	0.090	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20264	0.0	984	500	1.000	1.000	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
2	P31361	0.0	967	497	0.990	0.996	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2
3	Q63262	0.0	966	497	0.988	0.994	PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou3f3 PE=1 SV=2
4	Q2VUE0	9.19e-154	440	260	0.464	0.892	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
5	A0A2R8Y739	1.95e-129	382	361	0.510	0.706	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
6	P79746	1.87e-128	380	378	0.510	0.675	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
7	P49335	1.94e-128	379	361	0.508	0.704	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
8	P62515	9.05e-128	378	361	0.498	0.690	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
9	P62516	9.05e-128	378	361	0.498	0.690	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
10	P20265	2.50e-126	377	443	0.566	0.639	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
11	P31360	5.33e-126	376	445	0.566	0.636	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
12	P56222	1.22e-122	368	445	0.562	0.631	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
13	Q03052	1.54e-102	316	451	0.304	0.337	PO3F1_HUMAN POU domain, class 3, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU3F1 PE=2 SV=3
14	P20267	2.01e-102	316	451	0.304	0.337	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
15	P16241	2.15e-102	315	427	0.318	0.372	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
16	P21952	3.21e-102	315	449	0.304	0.339	PO3F1_MOUSE POU domain, class 3, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou3f1 PE=1 SV=1
17	O73861	6.94e-101	309	372	0.428	0.575	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
18	P20268	1.79e-79	254	380	0.252	0.332	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
19	A7Y7W2	2.05e-71	234	389	0.214	0.275	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
20	P31362	3.58e-65	219	431	0.226	0.262	PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou2f3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.2e+02	14.1	Homeobox KN domain
2	PF00046 Homeodomain	2.4e-15	67.4	Homeodomain
3	PF13560 HTH_31	86	14.9	Helix-turn-helix domain
4	PF00157 Pou	4.9e-34	127.5	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251496	0.941	Condensin complex subunit 3
2	9606.ENSP00000320147	0.886	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000266744	0.818	Achaete-scute homolog 1
4	9606.ENSP00000396103	0.794	Myelin transcription factor 1-like protein
5	9606.ENSP00000296946	0.785	Brachyury protein
6	9606.ENSP00000322568	0.744	Transcription factor SOX-11
7	9606.ENSP00000374205	0.728	T-box brain protein 1
8	9606.ENSP00000240423	0.679	Condensin complex subunit 2
9	9606.ENSP00000355718	0.660	Delta-like protein 1
10	9606.ENSP00000367408	0.638	Peripheral plasma membrane protein CASK
11	9606.ENSP00000323588	0.596	Transcription factor SOX-2
12	9606.ENSP00000477829	0.581	LIM/homeobox protein Lhx1
13	9606.ENSP00000293894	0.575	Transcription factor SOX-8
14	9606.ENSP00000366347	0.559	Homeobox protein Nkx-2.2
15	9606.ENSP00000251020	0.539	Sal-like protein 1
16	9606.ENSP00000330218	0.530	Transcription factor SOX-1
17	9606.ENSP00000348460	0.528	Neuronal PAS domain-containing protein 3
18	9606.ENSP00000362717	0.528	LIM/homeobox protein Lhx2
19	9606.ENSP00000380093	0.528	Transcription factor SOX-10
20	9606.ENSP00000339004	0.526	Forkhead box protein G1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0042802	0.995	identical protein binding
GO:0042803	0.986	protein homodimerization activity
GO:1990837	0.947	sequence-specific double-stranded DNA binding
GO:0000981	0.826	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.785	transcription regulatory region nucleic acid binding
GO:0000976	0.784	transcription cis-regulatory region binding
GO:0000977	0.459	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.415	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.368	DNA-binding transcription activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0009889	0.997	regulation of biosynthetic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0010468	0.997	regulation of gene expression
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:2001141	0.978	regulation of RNA biosynthetic process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0048518	0.964	positive regulation of biological process
GO:0007275	0.960	multicellular organism development
GO:0048522	0.948	positive regulation of cellular process
GO:0009893	0.928	positive regulation of metabolic process
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0031325	0.909	positive regulation of cellular metabolic process
GO:0051173	0.901	positive regulation of nitrogen compound metabolic process
GO:0048731	0.900	system development
GO:0007399	0.890	nervous system development
GO:0045893	0.888	positive regulation of DNA-templated transcription
GO:0006357	0.774	regulation of transcription by RNA polymerase II
GO:0009987	0.712	cellular process
GO:0048523	0.466	negative regulation of cellular process
GO:0045944	0.440	positive regulation of transcription by RNA polymerase II
GO:0009892	0.405	negative regulation of metabolic process
GO:0010605	0.401	negative regulation of macromolecule metabolic process
GO:0051172	0.320	negative regulation of nitrogen compound metabolic process
GO:0051253	0.309	negative regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.977	intracellular organelle lumen
GO:0031981	0.973	nuclear lumen
GO:0005654	0.948	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]