StarFunc result for job id P20265

User Input

>input (443 residues)
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31360	0.647	0.644	3.863E-56	445	1.000	0.996	P31360.pdb.gz	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
2	AFDB:O73861	0.359	0.426	4.270E-28	372	0.519	0.618	O73861.pdb.gz	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
3	AFDB:Q2VUE0	0.381	0.632	4.776E-28	260	0.445	0.758	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
4	AFDB:G3V7L5	0.204	0.217	1.433E-15	412	0.287	0.308	G3V7L5.pdb.gz	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
5	AFDB:P13528	0.292	0.278	8.602E-15	467	0.287	0.272	P13528.pdb.gz	UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans OX=6239 GN=unc-86 PE=1 SV=2
6	AFDB:Q90435	0.228	0.288	3.299E-14	331	0.235	0.314	Q90435.pdb.gz	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
7	AFDB:A0A1C7CYY7	0.307	0.239	2.081E-12	577	0.239	0.184	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
8	AFDB:Q5MD19	0.216	0.210	5.220E-7	461	0.199	0.191	Q5MD19.pdb.gz
9	PDB:6t90K	0.148	0.887	8.686E-7	73	0.117	0.712	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
10	AFDB:Q9NJB5	0.218	0.106	2.615E-4	1081	0.172	0.070	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
11	AFDB:P02833	0.151	0.174	1.186E-3	378	0.163	0.190	P02833.pdb.gz	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
12	PDB:4egcA	0.117	0.101	1.253E-2	539	0.077	0.063	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:5iplF	0.096	0.122	9.408E-2	277	0.065	0.105	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
14	PDB:2hi3A	0.116	0.598	5.647E-1	73	0.034	0.205	2hi3A.pdb.gz
15	PDB:6zh5A	0.075	0.157	5.972E-1	178	0.056	0.140	6zh5A.pdb.gz
16	PDB:7f0rF	0.093	0.133	6.316E-1	278	0.061	0.097	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
17	PDB:3g46A	0.066	0.155	7.902E-1	146	0.054	0.164	3g46A.pdb.gz	Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
18	PDB:7fbyA	0.097	0.245	7.902E-1	153	0.018	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
19	PDB:6dv9F	0.069	0.117	8.358E-1	174	0.045	0.115	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:6tz402	0.061	0.137	1.463	176	0.045	0.114	6tz402.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20265	0.0	886	443	1.000	1.000	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
2	P31360	0.0	881	445	1.000	0.996	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
3	P56222	0.0	865	445	0.991	0.987	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
4	P79746	0.0	520	378	0.670	0.786	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
5	A0A2R8Y739	1.13e-132	388	361	0.560	0.687	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
6	P62515	2.15e-132	387	361	0.562	0.690	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
7	P62516	2.15e-132	387	361	0.562	0.690	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
8	P49335	1.20e-131	385	361	0.558	0.684	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
9	Q2VUE0	1.59e-120	353	260	0.442	0.754	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
10	Q63262	2.24e-117	354	497	0.393	0.350	PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou3f3 PE=1 SV=2
11	P31361	2.64e-117	353	497	0.393	0.350	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2
12	P20264	2.80e-117	354	500	0.393	0.348	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
13	O73861	2.21e-115	344	372	0.429	0.511	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
14	Q03052	2.26e-103	317	451	0.345	0.339	PO3F1_HUMAN POU domain, class 3, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU3F1 PE=2 SV=3
15	P21952	5.81e-103	315	449	0.345	0.341	PO3F1_MOUSE POU domain, class 3, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou3f1 PE=1 SV=1
16	P20267	7.92e-103	315	451	0.345	0.339	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
17	P16241	1.50e-100	308	427	0.332	0.344	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
18	P20268	4.28e-77	246	380	0.284	0.332	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
19	A7Y7W2	3.65e-71	231	389	0.246	0.280	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
20	P31362	3.02e-64	214	431	0.257	0.265	PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou2f3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10846 DUF2722	0.53	20.8	Protein of unknown function (DUF2722)
2	PF05920 Homeobox_KN	8.3	17.7	Homeobox KN domain
3	PF00046 Homeodomain	1.6e-15	68.0	Homeodomain
4	PF13560 HTH_31	7.4	18.3	Helix-turn-helix domain
5	PF00157 Pou	3.9e-34	127.7	Pou domain - N-terminal to homeobox domain
6	PF06682 SARAF	24	16.1	SOCE-associated regulatory factor of calcium homoeostasis
7	PF12090 Spt20	19	16.4	Spt20 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10042.XP_006979314.1

Rank	PPI partner	STRING score	Description
1	10042.XP_006971167.1	0.765	Transcription factor SOX-2
2	10042.XP_006979198.1	0.751	Transcription factor SOX-10
3	10042.XP_006979922.1	0.731	Achaete-scute homolog 1
4	10042.XP_006972811.1	0.703	E3 SUMO-protein ligase EGR2
5	10042.XP_006989849.1	0.703	Myelin transcription factor 1-like protein isoform X2
6	10042.XP_006993452.1	0.650	Sal-like protein 2 isoform X1
7	10042.XP_006997577.1	0.594	Polyglutamine-binding protein 1 isoform X1
8	10042.XP_006990296.1	0.584	Aryl hydrocarbon receptor nuclear translocator 2 isoform X2
9	10042.XP_006970460.1	0.573	Neurogenin-2
10	10042.XP_006984683.1	0.571	T-box brain protein 1
11	10042.XP_006971759.1	0.567	B-cell lymphoma/leukemia 11B isoform X1
12	10042.XP_006975875.1	0.563	Melanoma antigen recognized by T-cells 1
13	10042.XP_006972189.1	0.562	Paired box protein Pax-3 isoform X1
14	10042.XP_006973979.1	0.556	Zinc finger E-box-binding homeobox 1
15	10042.XP_006975926.1	0.546	Paired box protein Pax-6 isoform X1
16	10042.XP_006981402.1	0.544	Transcription factor SOX-1
17	10042.XP_006995561.1	0.527	Microcephalin
18	10042.XP_006974959.1	0.525	DNA-binding protein SATB2
19	10042.XP_006980997.1	0.525	Transcription factor SOX-11
20	10042.XP_006981292.1	0.524	Brain-specific homeobox protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.988	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0031323	0.979	regulation of cellular metabolic process
GO:0009889	0.978	regulation of biosynthetic process
GO:0048518	0.975	positive regulation of biological process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0032502	0.957	developmental process
GO:0010556	0.928	regulation of macromolecule biosynthetic process
GO:0051252	0.927	regulation of RNA metabolic process
GO:0048856	0.922	anatomical structure development
GO:0006355	0.917	regulation of DNA-templated transcription
GO:0032501	0.897	multicellular organismal process
GO:0048522	0.872	positive regulation of cellular process
GO:0009987	0.860	cellular process
GO:0007275	0.836	multicellular organism development
GO:0048731	0.783	system development
GO:0009893	0.746	positive regulation of metabolic process
GO:0010604	0.723	positive regulation of macromolecule metabolic process
GO:0006357	0.674	regulation of transcription by RNA polymerase II
GO:0007399	0.665	nervous system development
GO:0031325	0.622	positive regulation of cellular metabolic process
GO:0051173	0.614	positive regulation of nitrogen compound metabolic process
GO:0010557	0.574	positive regulation of macromolecule biosynthetic process
GO:0045893	0.564	positive regulation of DNA-templated transcription
GO:0045944	0.553	positive regulation of transcription by RNA polymerase II
GO:0048513	0.478	animal organ development
GO:0048519	0.461	negative regulation of biological process
GO:0030154	0.436	cell differentiation
GO:0048523	0.344	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.985	nucleoplasm
GO:0005667	0.428	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]