StarFunc result for job id P20290

User Input

>input (206 residues)
MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQA
QVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNN
PKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPL
ATGEDDDDEVPDLVENFDEASKNEAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20290	1.000	1.000	1.420E-33	206	1.000	1.000	P20290.pdb.gz	BTF3_HUMAN Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1
2	AFDB:Q96K17	0.585	0.755	1.640E-21	158	0.621	0.810	Q96K17.pdb.gz	BT3L4_HUMAN Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4 PE=1 SV=1
3	AFDB:Q18885	0.499	0.633	3.470E-17	161	0.481	0.615	Q18885.pdb.gz	BTF3_CAEEL Transcription factor BTF3 homolog OS=Caenorhabditis elegans OX=6239 GN=icd-1 PE=1 SV=1
4	AFDB:Q7KM15	0.559	0.672	8.250E-17	169	0.471	0.574	Q7KM15.pdb.gz	Q7KM15_DROME Transcription factor BTF3 OS=Drosophila melanogaster OX=7227 GN=bic PE=1 SV=1
5	AFDB:D6RDG3	0.364	0.677	1.316E-14	109	0.524	0.991	D6RDG3.pdb.gz	D6RDG3_HUMAN Transcription factor BTF3 (Fragment) OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=3
6	AFDB:Q9CAT7	0.454	0.560	2.297E-14	165	0.403	0.503	Q9CAT7.pdb.gz	BTF3L_ARATH Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=At1g73230 PE=2 SV=1
7	AFDB:Q92371	0.452	0.606	2.130E-13	151	0.388	0.530	Q92371.pdb.gz	NACB_SCHPO Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=btf3 PE=2 SV=2
8	AFDB:Q02642	0.437	0.566	3.794E-10	157	0.257	0.338	Q02642.pdb.gz	NACB1_YEAST Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD1 PE=1 SV=2
9	AFDB:P40314	0.424	0.574	1.895E-9	149	0.209	0.289	P40314.pdb.gz	NACB2_YEAST Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BTT1 PE=1 SV=1
10	AFDB:Q383V9	0.371	0.655	1.869E-8	101	0.180	0.366	Q383V9.pdb.gz	Q383V9_TRYB2 Nascent polypeptide-associated complex subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1465 PE=3 SV=1
11	PDB:7qwrt	0.267	0.713	2.041E-4	67	0.073	0.224	7qwrt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
12	PDB:4gwqG	0.133	0.156	1.731E-1	170	0.063	0.076	4gwqG.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
13	PDB:4uhvB	0.087	0.031	1.841E-1	645	0.126	0.040	4uhvB.pdb.gz
14	PDB:7o2wA	0.159	0.089	1.841E-1	418	0.078	0.038	7o2wA.pdb.gz
15	PDB:4rewA	0.098	0.059	4.954E-1	411	0.073	0.036	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:1lc3A	0.110	0.085	5.270E-1	292	0.058	0.041	1lc3A.pdb.gz	Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
17	PDB:7nvrl	0.101	0.052	5.270E-1	501	0.024	0.010	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
18	PDB:7cunI	0.105	0.044	5.964E-1	624	0.049	0.016	7cunI.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
19	PDB:4rerA	0.120	0.069	6.750E-1	459	0.083	0.037	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:8ajmB	0.084	0.046	7.180E-1	395	0.049	0.025	8ajmB.pdb.gz	Recognition of the CCT5 di-Glu degron by CRL4 DCAF12 is dependent on TRiC assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20290	2.44e-151	419	206	1.000	1.000	BTF3_HUMAN Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1
2	Q64152	2.09e-130	367	204	0.947	0.956	BTF3_MOUSE Transcription factor BTF3 OS=Mus musculus OX=10090 GN=Btf3 PE=1 SV=3
3	Q5XGK2	2.14e-112	319	162	0.757	0.963	Q5XGK2_XENLA Transcription factor BTF3 OS=Xenopus laevis OX=8355 GN=btf3.S PE=2 SV=1
4	Q96K17	5.30e-84	247	158	0.621	0.810	BT3L4_HUMAN Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4 PE=1 SV=1
5	D6RDG3	1.36e-67	204	109	0.529	1.000	D6RDG3_HUMAN Transcription factor BTF3 (Fragment) OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=3
6	Q18885	8.72e-62	191	161	0.495	0.634	BTF3_CAEEL Transcription factor BTF3 homolog OS=Caenorhabditis elegans OX=6239 GN=icd-1 PE=1 SV=1
7	Q9U9Q7	8.50e-61	189	169	0.471	0.574	Q9U9Q7_DROME Transcription factor BTF3 OS=Drosophila melanogaster OX=7227 GN=bic PE=2 SV=1
8	Q7KM15	1.54e-55	176	169	0.471	0.574	Q7KM15_DROME Transcription factor BTF3 OS=Drosophila melanogaster OX=7227 GN=bic PE=1 SV=1
9	Q9SMW7	4.81e-49	159	165	0.413	0.515	BTF3_ARATH Basic transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=BTF3 PE=1 SV=1
10	Q9CAT7	6.41e-44	146	165	0.345	0.430	BTF3L_ARATH Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=At1g73230 PE=2 SV=1
11	Q92371	5.33e-43	143	151	0.408	0.556	NACB_SCHPO Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=btf3 PE=2 SV=2
12	Q02642	1.81e-21	88.2	157	0.286	0.376	NACB1_YEAST Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD1 PE=1 SV=2
13	Q383V9	1.01e-17	77.0	101	0.189	0.386	Q383V9_TRYB2 Nascent polypeptide-associated complex subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1465 PE=3 SV=1
14	P40314	1.40e-12	64.7	149	0.214	0.295	NACB2_YEAST Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BTT1 PE=1 SV=1
15	Q9VY34	2.19e-09	57.8	263	0.165	0.129	Q9VY34_DROME Transcription factor BTF3 OS=Drosophila melanogaster OX=7227 GN=betaNACtes4 PE=2 SV=1
16	Q6ICZ8	0.079	35.4	204	0.092	0.093	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
17	O15069	0.12	35.4	1562	0.073	0.010	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
18	Q9LHG9	0.13	34.7	203	0.087	0.089	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
19	Q13765	0.17	34.3	215	0.073	0.070	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
20	Q60817	0.17	34.3	215	0.073	0.070	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01849 NAC	1.6e-23	93.8	NAC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369965

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448035	0.999	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
2	9606.ENSP00000386717	0.998	Ribosomal protein L31
3	9606.ENSP00000389103	0.990	60S ribosomal protein L23a
4	9606.ENSP00000307889	0.989	Ribosomal protein L13
5	9606.ENSP00000346027	0.989	60S ribosomal protein L21
6	9606.ENSP00000363676	0.989	60S ribosomal protein L11
7	9606.ENSP00000262584	0.987	60S ribosomal protein L8
8	9606.ENSP00000225430	0.985	Ribosomal protein L19
9	9606.ENSP00000222247	0.984	Belongs to the eukaryotic ribosomal protein eL20 family.
10	9606.ENSP00000377640	0.982	Ribosomal protein L24
11	9606.ENSP00000416429	0.982	Ribosomal protein L32
12	9606.ENSP00000464342	0.982	60S ribosomal protein L36
13	9606.ENSP00000447001	0.981	60S ribosomal protein L18
14	9606.ENSP00000309830	0.980	Ribosomal protein L38
15	9606.ENSP00000397798	0.971	60S ribosomal protein L17
16	9606.ENSP00000309334	0.970	Ribosomal protein L15
17	9606.ENSP00000355315	0.970	Ribosomal protein L39
18	9606.ENSP00000361076	0.969	Ribosomal protein L7a
19	9606.ENSP00000449328	0.969	60S acidic ribosomal protein P0
20	9606.ENSP00000296674	0.966	40S ribosomal protein S23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.966	regulation of biological process
GO:0050794	0.958	regulation of cellular process
GO:0048519	0.757	negative regulation of biological process
GO:0048523	0.704	negative regulation of cellular process
GO:0060341	0.558	regulation of cellular localization
GO:0009987	0.540	cellular process
GO:0032880	0.512	regulation of protein localization
GO:0032502	0.494	developmental process
GO:1903828	0.439	negative regulation of protein localization
GO:0048856	0.385	anatomical structure development
GO:0032501	0.327	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.996	protein-containing complex
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005840	0.881	ribosome
GO:0031981	0.529	nuclear lumen
GO:0005854	0.419	nascent polypeptide-associated complex
GO:0016020	0.373	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]