StarFunc result for job id P20309

User Input

>input (590 residues)
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3W1	0.697	0.697	3.995E-62	590	1.000	1.000	A0A024R3W1.pdb.gz
2	AFDB:X1WHZ7	0.652	0.647	4.658E-41	595	0.581	0.576	X1WHZ7.pdb.gz
3	AFDB:P08912	0.567	0.627	6.120E-35	532	0.475	0.526	P08912.pdb.gz	ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Homo sapiens OX=9606 GN=CHRM5 PE=1 SV=2
4	AFDB:B3DKN8	0.516	0.611	1.194E-29	495	0.369	0.440	B3DKN8.pdb.gz	B3DKN8_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=2 SV=1
5	AFDB:A0A5F7ZKY2	0.506	0.602	2.841E-29	492	0.375	0.449	A0A5F7ZKY2.pdb.gz	A0A5F7ZKY2_MACMU Muscarinic acetylcholine receptor OS=Macaca mulatta OX=9544 GN=CHRM2 PE=3 SV=1
6	AFDB:P08173	0.507	0.622	5.213E-29	479	0.383	0.472	P08173.pdb.gz	ACM4_HUMAN Muscarinic acetylcholine receptor M4 OS=Homo sapiens OX=9606 GN=CHRM4 PE=1 SV=2
7	AFDB:P16395	0.546	0.405	4.155E-27	805	0.388	0.284	P16395.pdb.gz	ACM1_DROME Muscarinic acetylcholine receptor DM1 OS=Drosophila melanogaster OX=7227 GN=mAChR-A PE=2 SV=2
8	AFDB:Q9U7D5	0.522	0.504	1.805E-25	611	0.337	0.326	Q9U7D5.pdb.gz	ACM3_CAEEL Muscarinic acetylcholine receptor gar-3 OS=Caenorhabditis elegans OX=6239 GN=gar-3 PE=1 SV=2
9	PDB:4u14A	0.442	0.592	2.704E-25	436	0.464	0.628	4u14A.pdb.gz	Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.
10	PDB:6zfzA	0.467	0.612	1.338E-23	446	0.356	0.471	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
11	PDB:3uonA	0.445	0.590	2.133E-21	438	0.344	0.463	3uonA.pdb.gz	Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.
12	AFDB:A0A0B4LGX5	0.483	0.381	2.093E-20	755	0.234	0.183	A0A0B4LGX5.pdb.gz	A0A0B4LGX5_DROME Muscarinic acetylcholine Receptor, B-type, isoform B OS=Drosophila melanogaster OX=7227 GN=mAChR-B PE=3 SV=1
13	AFDB:Q9QYN8	0.509	0.665	2.185E-20	445	0.217	0.288	Q9QYN8.pdb.gz	HRH3_RAT Histamine H3 receptor OS=Rattus norvegicus OX=10116 GN=Hrh3 PE=2 SV=1
14	PDB:6u1nR	0.427	0.887	1.133E-16	278	0.310	0.658	6u1nR.pdb.gz	Structure of the M2 muscarinic receptor-beta-arrestin complex in a lipid nanodisc.
15	PDB:7f61A	0.465	0.890	2.161E-15	301	0.175	0.342	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
16	PDB:7e32R	0.417	0.843	8.988E-14	285	0.169	0.351	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:7e2xR	0.421	0.871	3.428E-12	278	0.164	0.349	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:6iblA	0.419	0.611	3.905E-12	397	0.149	0.222	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
19	PDB:5d5aA	0.437	0.578	4.078E-12	442	0.176	0.235	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
20	PDB:7xtcR	0.421	0.880	9.703E-12	275	0.168	0.360	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08483	0.0	1098	589	0.917	0.919	ACM3_RAT Muscarinic acetylcholine receptor M3 OS=Rattus norvegicus OX=10116 GN=Chrm3 PE=1 SV=1
2	P08912	0.0	523	532	0.497	0.551	ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Homo sapiens OX=9606 GN=CHRM5 PE=1 SV=2
3	P20309	0.0	1228	590	1.000	1.000	ACM3_HUMAN Muscarinic acetylcholine receptor M3 OS=Homo sapiens OX=9606 GN=CHRM3 PE=1 SV=1
4	Q9ERZ3	0.0	1098	589	0.917	0.919	ACM3_MOUSE Muscarinic acetylcholine receptor M3 OS=Mus musculus OX=10090 GN=Chrm3 PE=1 SV=1
5	Q920H4	2.36e-180	521	532	0.488	0.541	ACM5_MOUSE Muscarinic acetylcholine receptor M5 OS=Mus musculus OX=10090 GN=Chrm5 PE=2 SV=2
6	P08911	4.44e-180	521	531	0.492	0.546	ACM5_RAT Muscarinic acetylcholine receptor M5 OS=Rattus norvegicus OX=10116 GN=Chrm5 PE=1 SV=1
7	P08482	1.11e-168	489	460	0.454	0.583	ACM1_RAT Muscarinic acetylcholine receptor M1 OS=Rattus norvegicus OX=10116 GN=Chrm1 PE=1 SV=1
8	P12657	1.32e-168	489	460	0.454	0.583	ACM1_MOUSE Muscarinic acetylcholine receptor M1 OS=Mus musculus OX=10090 GN=Chrm1 PE=1 SV=2
9	P04761	9.14e-168	487	460	0.447	0.574	ACM1_PIG Muscarinic acetylcholine receptor M1 OS=Sus scrofa OX=9823 GN=CHRM1 PE=2 SV=1
10	P11229	2.23e-167	486	460	0.451	0.578	ACM1_HUMAN Muscarinic acetylcholine receptor M1 OS=Homo sapiens OX=9606 GN=CHRM1 PE=1 SV=2
11	P08172	1.03e-137	410	466	0.378	0.479	ACM2_HUMAN Muscarinic acetylcholine receptor M2 OS=Homo sapiens OX=9606 GN=CHRM2 PE=1 SV=1
12	A0A5F7ZKY2	3.32e-137	410	492	0.380	0.455	A0A5F7ZKY2_MACMU Muscarinic acetylcholine receptor OS=Macaca mulatta OX=9544 GN=CHRM2 PE=3 SV=1
13	P32211	7.90e-136	406	479	0.392	0.482	ACM4_MOUSE Muscarinic acetylcholine receptor M4 OS=Mus musculus OX=10090 GN=Chrm4 PE=2 SV=1
14	Q9ERZ4	2.07e-134	402	466	0.375	0.474	ACM2_MOUSE Muscarinic acetylcholine receptor M2 OS=Mus musculus OX=10090 GN=Chrm2 PE=1 SV=2
15	B3DKN8	4.36e-134	402	495	0.378	0.451	B3DKN8_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=2 SV=1
16	P10980	5.37e-134	401	466	0.375	0.474	ACM2_RAT Muscarinic acetylcholine receptor M2 OS=Rattus norvegicus OX=10116 GN=Chrm2 PE=1 SV=2
17	Q801M4	1.36e-132	398	495	0.375	0.446	Q801M4_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=3 SV=1
18	Q9U7D5	1.02e-108	340	611	0.347	0.336	ACM3_CAEEL Muscarinic acetylcholine receptor gar-3 OS=Caenorhabditis elegans OX=6239 GN=gar-3 PE=1 SV=2
19	P08173	3.48e-94	298	479	0.244	0.301	ACM4_HUMAN Muscarinic acetylcholine receptor M4 OS=Homo sapiens OX=9606 GN=CHRM4 PE=1 SV=2
20	P08485	1.10e-93	297	478	0.249	0.308	ACM4_RAT Muscarinic acetylcholine receptor M4 OS=Rattus norvegicus OX=10116 GN=Chrm4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	4.4e-74	260.7	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.038	25.4	Olfactory receptor
3	PF10316 7TM_GPCR_Srbc	0.68	21.0	Serpentine type 7TM GPCR chemoreceptor Srbc
4	PF10320 7TM_GPCR_Srsx	2.4e-05	35.4	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.935	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000372750	0.866	Muscarinic acetylcholine receptor M5
3	9606.ENSP00000306138	0.860	Metabotropic glutamate receptor 5
4	9606.ENSP00000078429	0.830	Guanine nucleotide-binding protein subunit alpha-11
5	9606.ENSP00000306490	0.823	Muscarinic acetylcholine receptor M1
6	9606.ENSP00000258302	0.821	Regulator of G-protein signaling 8
7	9606.ENSP00000360021	0.814	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
8	9606.ENSP00000265023	0.801	Kininogen-1
9	9606.ENSP00000319713	0.746	Type-1 angiotensin II receptor-associated protein
10	9606.ENSP00000338185	0.745	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
11	9606.ENSP00000260402	0.702	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
12	9606.ENSP00000443631	0.694	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
13	9606.ENSP00000407546	0.674	Neuronal acetylcholine receptor subunit alpha-7
14	9606.ENSP00000334051	0.638	Guanine nucleotide-binding protein G(olf) subunit alpha
15	9606.ENSP00000360141	0.635	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
16	9606.ENSP00000365807	0.618	Guanine nucleotide-binding protein subunit alpha-14
17	9606.ENSP00000262958	0.616	Guanine nucleotide-binding protein subunit alpha-15
18	9606.ENSP00000346414	0.616	Leucine rich repeats and IQ motif containing 3
19	9606.ENSP00000297156	0.609	Calcium signal-modulating cyclophilin ligand
20	9606.ENSP00000258385	0.576	Acetylcholine receptor subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016907	1.000	G protein-coupled acetylcholine receptor activity
GO:0005488	0.988	binding
GO:0005515	0.978	protein binding
GO:0003824	0.344	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007267	0.995	cell-cell signaling
GO:0071417	0.995	cellular response to organonitrogen compound
GO:0095500	0.993	acetylcholine receptor signaling pathway
GO:0032501	0.964	multicellular organismal process
GO:0007186	0.944	G protein-coupled receptor signaling pathway
GO:0065008	0.440	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.503	organelle
GO:0005622	0.447	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]