StarFunc result for job id P20333

User Input

>input (461 residues)
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20333	1.000	1.000	1.267E-71	461	1.000	1.000	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
2	AFDB:Q80WY6	0.421	0.411	3.017E-48	474	0.620	0.603	Q80WY6.pdb.gz	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
3	AFDB:P25119	0.425	0.415	1.096E-46	474	0.633	0.616	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
4	AFDB:F1RAS9	0.323	0.346	9.681E-23	425	0.252	0.273	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
5	AFDB:Q80T91	0.118	0.063	7.430E-3	1091	0.171	0.072	Q80T91.pdb.gz	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
6	AFDB:E9QJQ6	0.114	0.057	2.549E-1	1119	0.167	0.069	E9QJQ6.pdb.gz	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
7	AFDB:Q6DIB5	0.098	0.052	3.390E-1	1147	0.154	0.062	Q6DIB5.pdb.gz	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
8	AFDB:Q5FVU4	0.079	0.072	3.799E-1	597	0.145	0.112	Q5FVU4.pdb.gz	Q5FVU4_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
9	PDB:1c1zA	0.119	0.156	6.106E-1	326	0.061	0.086	1c1zA.pdb.gz
10	AFDB:Q57XZ5	0.069	0.046	8.441E-1	787	0.089	0.052	Q57XZ5.pdb.gz	Q57XZ5_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.830 PE=3 SV=1
11	AFDB:A8CVX7	0.058	0.039	1.258	778	0.117	0.069	A8CVX7.pdb.gz	TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1
12	PDB:7dtvA	0.102	0.070	1.281	779	0.043	0.026	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
13	PDB:8a7eC	0.124	0.056	2.689	1524	0.061	0.018	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
14	PDB:7wihA	0.079	0.052	2.847	741	0.026	0.016	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
15	PDB:7aavv	0.068	0.146	4.008	206	0.039	0.087	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
16	PDB:3besR	0.046	0.077	6.696	250	0.024	0.044	3besR.pdb.gz
17	PDB:7rdqD	0.045	0.017	6.696	1366	0.020	0.007	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
18	PDB:7epcA	0.090	0.062	7.505	782	0.041	0.024	7epcA.pdb.gz
19	PDB:6hv93	0.038	0.033	7.945	558	0.015	0.013	6hv93.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
20	PDB:5a09A	0.054	0.091	8.905	218	0.037	0.078	5a09A.pdb.gz	Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20333	0.0	933	461	1.000	1.000	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
2	P25119	9.92e-175	500	474	0.636	0.618	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
3	Q80WY6	6.21e-150	437	474	0.625	0.608	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
4	O00300	2.39e-28	118	401	0.143	0.165	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
5	O08727	6.35e-26	111	401	0.152	0.175	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
6	F1RAS9	6.19e-25	108	425	0.130	0.141	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
7	O08712	1.95e-24	107	401	0.150	0.172	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
8	O95407	2.16e-24	104	300	0.130	0.200	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
9	Q8UYL3	2.12e-23	98.6	167	0.117	0.323	Q8UYL3_9POXV CrmE protein OS=Vaccinia virus OX=10245 GN=crmE PE=1 SV=1
10	P25942	1.06e-22	99.8	277	0.141	0.235	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
11	P36941	2.41e-22	101	435	0.167	0.177	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
12	A5D8S6	5.51e-20	95.1	637	0.121	0.088	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
13	F5H6F8	9.04e-20	89.7	217	0.165	0.350	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
14	P50284	1.97e-19	92.4	415	0.128	0.142	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
15	O75509	4.13e-19	92.4	655	0.128	0.090	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
16	D3ZF92	1.34e-18	90.9	655	0.124	0.087	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
17	Q9Y6Q6	1.50e-18	90.5	616	0.132	0.099	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
18	Q9EPU5	1.99e-18	90.5	655	0.204	0.144	TNR21_MOUSE Tumor necrosis factor receptor superfamily member 21 OS=Mus musculus OX=10090 GN=Tnfrsf21 PE=1 SV=2
19	O35305	1.08e-16	85.1	625	0.124	0.091	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
20	F1M8Z6	2.22e-16	84.0	633	0.124	0.090	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00020 TNFR_c6	5.1e-22	89.4	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362994	0.999	TNF receptor-associated factor 1
2	9606.ENSP00000398698	0.999	Tumor necrosis factor
3	9606.ENSP00000162749	0.998	Tumor necrosis factor receptor superfamily member 1A
4	9606.ENSP00000247668	0.998	TNF receptor-associated factor 2
5	9606.ENSP00000403495	0.997	Lymphotoxin-alpha
6	9606.ENSP00000477613	0.980	Baculoviral IAP repeat-containing protein 2
7	9606.ENSP00000341268	0.978	Tumor necrosis factor receptor type 1-associated DEATH domain protein
8	9606.ENSP00000454207	0.972	TNF receptor-associated factor 3
9	9606.ENSP00000263464	0.966	Baculoviral IAP repeat-containing protein 3
10	9606.ENSP00000309968	0.964	Disintegrin and metalloproteinase domain-containing protein 17
11	9606.ENSP00000412237	0.960	Interleukin-10
12	9606.ENSP00000264832	0.958	Intercellular adhesion molecule 1
13	9606.ENSP00000357470	0.956	Interleukin-6 receptor subunit alpha
14	9606.ENSP00000259206	0.953	Interleukin-1 receptor antagonist protein
15	9606.ENSP00000373487	0.947	Keratin, type I cytoskeletal 18
16	9606.ENSP00000259808	0.944	Receptor-interacting serine/threonine-protein kinase 1
17	9606.ENSP00000292303	0.943	C-C chemokine receptor type 5
18	9606.ENSP00000296140	0.941	C-C chemokine receptor type 1
19	9606.ENSP00000376505	0.937	TRAF family member-associated NF-kappa-B activator
20	9606.ENSP00000292301	0.936	C-C chemokine receptor type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005035	1.000	death receptor activity
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0019955	0.997	cytokine binding
GO:0005031	0.955	tumor necrosis factor receptor activity
GO:0043120	0.574	tumor necrosis factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0007154	0.986	cell communication
GO:0071345	0.985	cellular response to cytokine stimulus
GO:0007165	0.982	signal transduction
GO:0048518	0.966	positive regulation of biological process
GO:0048522	0.960	positive regulation of cellular process
GO:0031325	0.952	positive regulation of cellular metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0051171	0.934	regulation of nitrogen compound metabolic process
GO:0010604	0.930	positive regulation of macromolecule metabolic process
GO:0007166	0.927	cell surface receptor signaling pathway
GO:0009605	0.918	response to external stimulus
GO:0009607	0.916	response to biotic stimulus
GO:0019221	0.902	cytokine-mediated signaling pathway
GO:0051246	0.896	regulation of protein metabolic process
GO:0051173	0.858	positive regulation of nitrogen compound metabolic process
GO:0051707	0.844	response to other organism
GO:0034612	0.834	response to tumor necrosis factor
GO:0051247	0.811	positive regulation of protein metabolic process
GO:0009894	0.749	regulation of catabolic process
GO:0048583	0.730	regulation of response to stimulus
GO:0048519	0.565	negative regulation of biological process
GO:0010468	0.460	regulation of gene expression
GO:0009617	0.453	response to bacterium
GO:0051239	0.421	regulation of multicellular organismal process
GO:0048523	0.418	negative regulation of cellular process
GO:0006950	0.416	response to stress
GO:0033209	0.405	tumor necrosis factor-mediated signaling pathway
GO:0010941	0.379	regulation of cell death
GO:0048584	0.364	positive regulation of response to stimulus
GO:0009889	0.363	regulation of biosynthetic process
GO:0051240	0.362	positive regulation of multicellular organismal process
GO:0002376	0.343	immune system process
GO:0071216	0.342	cellular response to biotic stimulus
GO:1901700	0.337	response to oxygen-containing compound
GO:0071219	0.334	cellular response to molecule of bacterial origin
GO:0043067	0.333	regulation of programmed cell death
GO:0030162	0.329	regulation of proteolysis
GO:0010556	0.313	regulation of macromolecule biosynthetic process
GO:0031326	0.312	regulation of cellular biosynthetic process
GO:0071222	0.310	cellular response to lipopolysaccharide
GO:0009966	0.302	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0031982	0.991	vesicle
GO:0032991	0.967	protein-containing complex
GO:0031090	0.917	organelle membrane
GO:0031410	0.896	cytoplasmic vesicle
GO:0030659	0.699	cytoplasmic vesicle membrane
GO:0043235	0.690	receptor complex
GO:0099503	0.684	secretory vesicle
GO:0098588	0.678	bounding membrane of organelle
GO:0030141	0.662	secretory granule
GO:0030667	0.640	secretory granule membrane
GO:0005576	0.620	extracellular region
GO:0005634	0.588	nucleus
GO:0005615	0.562	extracellular space
GO:0045121	0.553	membrane raft
GO:0070013	0.530	intracellular organelle lumen
GO:0031981	0.426	nuclear lumen
GO:0002947	0.398	tumor necrosis factor receptor superfamily complex
GO:0042581	0.372	specific granule
GO:0005654	0.333	nucleoplasm
GO:0035579	0.326	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]