StarFunc result for job id P20336

User Input

>input (220 residues)
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11023	0.966	0.966	3.759E-45	220	0.986	0.986	P11023.pdb.gz	RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus OX=9913 GN=RAB3A PE=1 SV=3
2	AFDB:P62823	0.856	0.831	4.608E-41	227	0.827	0.802	P62823.pdb.gz	RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus OX=10090 GN=Rab3c PE=1 SV=1
3	AFDB:P20337	0.842	0.845	1.990E-39	219	0.773	0.776	P20337.pdb.gz	RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens OX=9606 GN=RAB3B PE=1 SV=2
4	AFDB:P25228	0.843	0.843	1.017E-38	220	0.782	0.782	P25228.pdb.gz	RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster OX=7227 GN=Rab3 PE=1 SV=1
5	AFDB:O95716	0.842	0.845	1.334E-37	219	0.768	0.772	O95716.pdb.gz	RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens OX=9606 GN=RAB3D PE=1 SV=1
6	AFDB:Q95QV3	0.846	0.801	3.555E-35	233	0.732	0.691	Q95QV3.pdb.gz	Q95QV3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans OX=6239 GN=rab-3 PE=1 SV=1
7	PDB:1zbdA	0.790	0.980	4.423E-35	177	0.786	0.977	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
8	PDB:8a4cB	0.760	0.982	5.091E-31	170	0.664	0.859	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
9	AFDB:A4FVK4	0.808	0.858	1.559E-29	207	0.445	0.473	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
10	AFDB:Q9SF91	0.816	0.824	3.753E-29	218	0.455	0.459	Q9SF91.pdb.gz	RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana OX=3702 GN=RABE1E PE=1 SV=1
11	AFDB:A5PLC7	0.809	0.852	9.036E-29	209	0.427	0.450	A5PLC7.pdb.gz	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
12	AFDB:Q9FPJ4	0.760	0.827	9.621E-29	202	0.418	0.455	Q9FPJ4.pdb.gz	RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana OX=3702 GN=RABD2B PE=1 SV=1
13	PDB:6y7gB	0.704	0.931	1.124E-28	165	0.668	0.891	6y7gB.pdb.gz	Structure of the human RAB3C in complex with GDP
14	PDB:5sziA	0.762	0.960	1.169E-26	174	0.432	0.546	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:5szjA	0.758	0.950	2.870E-25	175	0.409	0.514	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
16	PDB:5szhB	0.751	0.940	8.341E-25	175	0.377	0.474	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
17	PDB:6if2B	0.765	0.940	1.320E-23	178	0.345	0.427	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
18	PDB:2ew1A	0.734	0.936	1.593E-23	171	0.336	0.433	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
19	PDB:2zetA	0.759	0.918	3.602E-23	181	0.341	0.414	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
20	PDB:2f9mA	0.744	0.890	1.047E-22	182	0.323	0.390	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20336	2.04e-167	461	220	1.000	1.000	RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens OX=9606 GN=RAB3A PE=1 SV=1
2	P63011	2.43e-166	458	220	0.991	0.991	RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1
3	P63012	2.43e-166	458	220	0.991	0.991	RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus OX=10116 GN=Rab3a PE=1 SV=1
4	P11023	6.18e-166	457	220	0.986	0.986	RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus OX=9913 GN=RAB3A PE=1 SV=3
5	Q96E17	4.84e-141	395	227	0.841	0.815	RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens OX=9606 GN=RAB3C PE=1 SV=1
6	P62823	2.43e-139	390	227	0.832	0.806	RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus OX=10090 GN=Rab3c PE=1 SV=1
7	P62824	2.43e-139	390	227	0.832	0.806	RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus OX=10116 GN=Rab3c PE=1 SV=1
8	Q9CZT8	4.20e-131	369	219	0.786	0.790	RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus OX=10090 GN=Rab3b PE=1 SV=1
9	Q63941	5.11e-130	367	219	0.777	0.781	RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus OX=10116 GN=Rab3b PE=1 SV=2
10	P20337	7.76e-130	366	219	0.777	0.781	RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens OX=9606 GN=RAB3B PE=1 SV=2
11	P25228	1.11e-126	358	220	0.786	0.786	RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster OX=7227 GN=Rab3 PE=1 SV=1
12	P35276	1.69e-126	358	219	0.764	0.767	RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus OX=10090 GN=Rab3d PE=1 SV=1
13	O95716	1.97e-125	355	219	0.768	0.772	RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens OX=9606 GN=RAB3D PE=1 SV=1
14	Q63942	4.01e-125	354	219	0.759	0.763	RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus OX=10116 GN=Rab3d PE=1 SV=2
15	Q95QV3	6.93e-118	337	233	0.732	0.691	Q95QV3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans OX=6239 GN=rab-3 PE=1 SV=1
16	Q94986	8.57e-118	336	219	0.732	0.735	RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans OX=6239 GN=rab-3 PE=1 SV=1
17	P61006	5.84e-70	214	207	0.468	0.498	RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1
18	P61007	5.84e-70	214	207	0.468	0.498	RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris OX=9615 GN=RAB8A PE=1 SV=1
19	Q4W9I4	8.95e-70	214	206	0.418	0.447	Q4W9I4_ASPFU Rab GTPase SrgA, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G04810 PE=4 SV=1
20	P35280	1.88e-69	213	207	0.455	0.483	RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus OX=10116 GN=Rab8a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.9e+02	13.8	AAA ATPase domain
2	PF13479 AAA_24	72	14.5	AAA domain
3	PF00025 Arf	7.3e-11	53.3	ADP-ribosylation factor family
4	PF07931 CPT	39	15.5	Chloramphenicol phosphotransferase-like protein
5	PF02421 FeoB_N	1.6e+02	13.2	Ferrous iron transport protein B
6	PF10955 Fin	1e+02	14.6	Anti-sigma-F factor Fin
7	PF00503 G-alpha	2.3e+02	12.3	G-protein alpha subunit
8	PF00009 GTP_EFTU	5	18.1	Elongation factor Tu GTP binding domain
9	PF04670 Gtr1_RagA	15	16.4	Gtr1/RagA G protein conserved region
10	PF01926 MMR_HSR1	0.29	22.6	50S ribosome-binding GTPase
11	PF00071 Ras	1e-57	205.8	Ras family
12	PF08477 Roc	1.1e-29	114.5	Ras of Complex, Roc, domain of DAPkinase
13	PF03193 RsgA_GTPase	1.5e+02	13.7	RsgA GTPase
14	PF00735 Septin	1.7e+02	12.8	Septin
15	PF09439 SRPRB	0.027	25.4	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384935.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010367050.1	0.989	rabphilin-3A isoform X1
2	61622.XP_010369726.1	0.989	Regulating synaptic membrane exocytosis protein 1 isoform X1
3	61622.XP_010352824.1	0.982	Regulating synaptic membrane exocytosis 2
4	61622.XP_010351040.1	0.917	Protein piccolo-like
5	61622.XP_010378481.1	0.913	Synaptotagmin-like protein 4 isoform X1
6	61622.XP_010366658.1	0.890	CHM, Rab escort protein 1
7	61622.XP_010375915.1	0.871	Glutamate decarboxylase 1 isoform X1
8	61622.XP_010378724.1	0.864	Synaptotagmin-1 isoform X1
9	61622.XP_010371778.1	0.863	Rabphilin 3A-like (without C2 domains)
10	61622.XP_010359740.1	0.862	Protein unc-13 homolog A
11	61622.XP_010360722.1	0.850	Vesicle associated membrane protein 2
12	61622.XP_010366141.1	0.849	Belongs to the STXBP/unc-18/SEC1 family.
13	61622.XP_010357026.1	0.846	RAB3A interacting protein
14	61622.XP_010366901.1	0.829	Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of proteins with the C- terminal sequence -XXCC, -XCXC and -CCXX.
15	61622.XP_010368720.1	0.829	RAB3B, member RAS oncogene family
16	61622.XP_010363552.1	0.823	DnaJ heat shock protein family (Hsp40) member C5
17	61622.XP_010383003.1	0.821	CHM like, Rab escort protein 2
18	61622.XP_010384132.1	0.816	Unc-13 homolog B
19	61622.XP_010383220.1	0.808	RAB3A interacting protein like 1
20	61622.XP_010353572.1	0.802	Belongs to the SNAP-25 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019001	0.902	guanyl nucleotide binding
GO:0003924	0.886	GTPase activity
GO:0032561	0.885	guanyl ribonucleotide binding
GO:0043168	0.865	anion binding
GO:0008092	0.526	cytoskeletal protein binding
GO:0017022	0.440	myosin binding
GO:0098772	0.417	molecular function regulator activity
GO:0031489	0.369	myosin V binding
GO:0035639	0.344	purine ribonucleoside triphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0051049	0.975	regulation of transport
GO:0060627	0.972	regulation of vesicle-mediated transport
GO:0006810	0.962	transport
GO:1903530	0.962	regulation of secretion by cell
GO:0017157	0.925	regulation of exocytosis
GO:0006836	0.916	neurotransmitter transport
GO:0001505	0.915	regulation of neurotransmitter levels
GO:0007268	0.887	chemical synaptic transmission
GO:0045055	0.860	regulated exocytosis
GO:0051047	0.823	positive regulation of secretion
GO:0051588	0.819	regulation of neurotransmitter transport
GO:1903305	0.762	regulation of regulated secretory pathway
GO:0050804	0.758	modulation of chemical synaptic transmission
GO:0046928	0.750	regulation of neurotransmitter secretion
GO:0051649	0.676	establishment of localization in cell
GO:0048522	0.600	positive regulation of cellular process
GO:0045921	0.593	positive regulation of exocytosis
GO:0050896	0.533	response to stimulus
GO:0007269	0.413	neurotransmitter secretion
GO:0071840	0.398	cellular component organization or biogenesis
GO:0032501	0.367	multicellular organismal process
GO:0099003	0.356	vesicle-mediated transport in synapse
GO:0016043	0.340	cellular component organization
GO:0051128	0.302	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0099503	0.996	secretory vesicle
GO:0045202	0.995	synapse
GO:0098793	0.994	presynapse
GO:0008021	0.956	synaptic vesicle
GO:0071944	0.917	cell periphery
GO:0031090	0.887	organelle membrane
GO:0030659	0.791	cytoplasmic vesicle membrane
GO:0005886	0.771	plasma membrane
GO:0098588	0.725	bounding membrane of organelle
GO:0030141	0.571	secretory granule
GO:0030658	0.482	transport vesicle membrane
GO:0005829	0.480	cytosol
GO:0030672	0.313	synaptic vesicle membrane
GO:0120025	0.303	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.886	GTP + H2O = GDP + H(+) + phosphate

[back to server]