StarFunc result for job id P20366

User Input

>input (129 residues)
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06767	0.488	0.484	4.672E-20	130	0.961	0.954	P06767.pdb.gz	TKN1_RAT Protachykinin-1 OS=Rattus norvegicus OX=10116 GN=Tac1 PE=2 SV=2
2	AFDB:Q793F9	0.134	0.058	2.606	437	0.109	0.032	Q793F9.pdb.gz	VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus OX=10116 GN=Vps4a PE=1 SV=1
3	AFDB:M0R8L2	0.191	0.210	3.249	116	0.124	0.138	M0R8L2.pdb.gz	SPXN_RAT Spexin OS=Rattus norvegicus OX=10116 GN=SPX PE=1 SV=1
4	AFDB:A0QNF5	0.165	0.157	4.359	136	0.124	0.118	A0QNF5.pdb.gz	CWSA_MYCS2 Cell wall synthesis protein CwsA OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=cwsA PE=1 SV=1
5	AFDB:Q580U2	0.199	0.119	4.359	275	0.147	0.069	Q580U2.pdb.gz	Q580U2_TRYB2 ADP-ribosylation factor GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.510 PE=4 SV=1
6	AFDB:Q4TZQ4	0.163	0.040	5.433	831	0.109	0.017	Q4TZQ4.pdb.gz	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
7	AFDB:Q9USY3	0.107	0.033	5.847	708	0.062	0.011	Q9USY3.pdb.gz	NAA35_SCHPO N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak10 PE=1 SV=1
8	AFDB:Q61985	0.229	0.048	6.293	741	0.147	0.026	Q61985.pdb.gz	NF2L1_MOUSE Endoplasmic reticulum membrane sensor NFE2L1 OS=Mus musculus OX=10090 GN=Nfe2l1 PE=1 SV=2
9	AFDB:P02817	0.144	0.099	7.844	213	0.062	0.038	P02817.pdb.gz	AMELX_BOVIN Amelogenin, X isoform OS=Bos taurus OX=9913 GN=AMELX PE=1 SV=2
10	AFDB:A0A0B4K6E2	0.121	0.026	8.442	973	0.132	0.017	A0A0B4K6E2.pdb.gz	A0A0B4K6E2_DROME Na/Ca-exchange protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
11	PDB:7jtsE	0.133	0.361	8.540	40	0.047	0.150	7jtsE.pdb.gz
12	PDB:6lqsr6	0.167	0.205	9.191	104	0.093	0.115	6lqsr6.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
13	PDB:7p5z1	0.122	0.061	9.892	336	0.101	0.039	7p5z1.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20366	2.77e-94	269	129	1.000	1.000	TKN1_HUMAN Protachykinin-1 OS=Homo sapiens OX=9606 GN=TAC1 PE=1 SV=1
2	P06767	1.69e-91	262	130	0.969	0.962	TKN1_RAT Protachykinin-1 OS=Rattus norvegicus OX=10116 GN=Tac1 PE=2 SV=2
3	P41539	3.27e-90	259	130	0.953	0.946	TKN1_MOUSE Protachykinin-1 OS=Mus musculus OX=10090 GN=Tac1 PE=2 SV=1
4	G5EGK1	0.10	34.3	2553	0.194	0.010	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
5	Q95XN3	0.18	33.5	996	0.194	0.025	Q95XN3_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
6	Q9VGE8	0.27	32.7	289	0.163	0.073	TACHY_DROME Tachykinins OS=Drosophila melanogaster OX=7227 GN=Tk PE=1 SV=1
7	Q9PRZ3	0.47	29.3	21	0.093	0.571	TKNG_ONCMY Neuropeptide gamma OS=Oncorhynchus mykiss OX=8022 PE=1 SV=1
8	Q86UU9	2.4	29.3	113	0.209	0.239	TKN4_HUMAN Tachykinin-4 OS=Homo sapiens OX=9606 GN=TAC4 PE=1 SV=1
9	A6MWS7	3.8	27.7	55	0.116	0.273	RIP14_CRIRI Riparin-1.4 OS=Crinia riparia OX=446489 PE=1 SV=1
10	P33438	4.2	29.3	1026	0.209	0.026	GLT_DROME Glutactin OS=Drosophila melanogaster OX=7227 GN=Glt PE=1 SV=2
11	P92208	7.2	28.5	372	0.062	0.022	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
12	A0A1D8PKQ8	9.8	28.1	472	0.101	0.028	A0A1D8PKQ8_CANAL Zfu2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZFU2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02202 Tachykinin	0.006	27.4	Tachykinin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321106

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303522	0.999	Substance-P receptor
2	9606.ENSP00000362403	0.999	Substance-K receptor
3	9606.ENSP00000302665	0.971	Insulin-like growth factor I
4	9606.ENSP00000481244	0.962	Phospholemman
5	9606.ENSP00000483110	0.936	Tachykinin-3
6	9606.ENSP00000256857	0.934	Gastrin-releasing peptide
7	9606.ENSP00000334042	0.934	Tachykinin-4
8	9606.ENSP00000303325	0.932	Neuromedin-K receptor
9	9606.ENSP00000459962	0.928	Transient receptor potential cation channel, subfamily V, member 1
10	9606.ENSP00000331746	0.917	Calcitonin
11	9606.ENSP00000356213	0.916	VIP peptides
12	9606.ENSP00000379472	0.916	Cholecystokinin
13	9606.ENSP00000256010	0.911	Neurotensin/neuromedin N
14	9606.ENSP00000384364	0.911	Pro-neuropeptide Y
15	9606.ENSP00000265023	0.909	Kininogen-1
16	9606.ENSP00000349588	0.907	Ankyrin-2
17	9606.ENSP00000426070	0.905	Short transient receptor potential channel 7
18	9606.ENSP00000287641	0.896	Somatostatin
19	9606.ENSP00000461007	0.889	Transient receptor potential cation channel subfamily V member 1
20	9606.ENSP00000265643	0.885	Galanin peptides

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031835	0.999	substance P receptor binding
GO:0098772	0.465	molecular function regulator activity
GO:0048018	0.368	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0006952	0.994	defense response
GO:0007600	0.993	sensory perception
GO:0050794	0.987	regulation of cellular process
GO:0065008	0.968	regulation of biological quality
GO:0048518	0.965	positive regulation of biological process
GO:0009987	0.957	cellular process
GO:0051239	0.956	regulation of multicellular organismal process
GO:0019233	0.943	sensory perception of pain
GO:0048522	0.917	positive regulation of cellular process
GO:0048519	0.884	negative regulation of biological process
GO:0040012	0.883	regulation of locomotion
GO:0007154	0.865	cell communication
GO:0023052	0.863	signaling
GO:2000145	0.863	regulation of cell motility
GO:0051716	0.861	cellular response to stimulus
GO:0007165	0.813	signal transduction
GO:0044419	0.792	biological process involved in interspecies interaction between organisms
GO:0009605	0.785	response to external stimulus
GO:0006954	0.785	inflammatory response
GO:0032886	0.769	regulation of microtubule-based process
GO:0051240	0.758	positive regulation of multicellular organismal process
GO:0071495	0.754	cellular response to endogenous stimulus
GO:0060632	0.736	regulation of microtubule-based movement
GO:0008015	0.732	blood circulation
GO:0007204	0.731	positive regulation of cytosolic calcium ion concentration
GO:0051606	0.726	detection of stimulus
GO:0044057	0.719	regulation of system process
GO:0009607	0.699	response to biotic stimulus
GO:0008217	0.661	regulation of blood pressure
GO:0042221	0.644	response to chemical
GO:1902019	0.643	regulation of cilium-dependent cell motility
GO:0003352	0.633	regulation of cilium movement
GO:1990089	0.627	response to nerve growth factor
GO:0048265	0.618	response to pain
GO:0071363	0.615	cellular response to growth factor stimulus
GO:0048583	0.491	regulation of response to stimulus
GO:0043207	0.488	response to external biotic stimulus
GO:0010033	0.470	response to organic substance
GO:0040017	0.469	positive regulation of locomotion
GO:0060295	0.446	regulation of cilium movement involved in cell motility
GO:0051707	0.435	response to other organism
GO:0031644	0.425	regulation of nervous system process
GO:0032879	0.420	regulation of localization
GO:0010646	0.406	regulation of cell communication
GO:0062149	0.402	detection of stimulus involved in sensory perception of pain
GO:0050951	0.399	sensory perception of temperature stimulus
GO:2000147	0.397	positive regulation of cell motility
GO:0051049	0.392	regulation of transport
GO:0007186	0.365	G protein-coupled receptor signaling pathway
GO:0048584	0.355	positive regulation of response to stimulus
GO:0098542	0.353	defense response to other organism
GO:0019222	0.333	regulation of metabolic process
GO:0023051	0.322	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.981	extracellular space
GO:0016020	0.882	membrane
GO:0005886	0.835	plasma membrane
GO:0005622	0.404	intracellular anatomical structure
GO:0043226	0.398	organelle
GO:0043227	0.358	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]