StarFunc result for job id P20393

User Input

>input (614 residues)
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RAU6	0.379	0.367	5.419E-46	637	0.616	0.593	F1RAU6.pdb.gz	F1RAU6_DANRE Nuclear receptor subfamily 1 group D member 1 OS=Danio rerio OX=7955 GN=Eip75B PE=3 SV=1
2	AFDB:A0A2R8QR22	0.312	0.392	1.007E-18	483	0.225	0.286	A0A2R8QR22.pdb.gz
3	AFDB:Q9PVE4	0.325	0.492	2.297E-18	395	0.192	0.299	Q9PVE4.pdb.gz	THB_DANRE Thyroid hormone receptor beta OS=Danio rerio OX=7955 GN=thrb PE=1 SV=2
4	AFDB:O18473	0.319	0.340	3.314E-18	576	0.208	0.222	O18473.pdb.gz	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
5	AFDB:P41828	0.272	0.284	3.314E-18	588	0.251	0.262	P41828.pdb.gz	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2
6	AFDB:A1ZA01	0.219	0.230	2.247E-16	582	0.218	0.230	A1ZA01.pdb.gz	A1ZA01_DROME Hormone receptor 51 OS=Drosophila melanogaster OX=7227 GN=Hr51 PE=2 SV=2
7	AFDB:P41830	0.316	0.361	3.894E-16	534	0.212	0.243	P41830.pdb.gz	CNR14_CAEEL Steroid hormone receptor family member cnr14 OS=Caenorhabditis elegans OX=6239 GN=sex-1 PE=2 SV=2
8	AFDB:Q6Q6F3	0.300	0.524	1.342E-15	344	0.173	0.308	Q6Q6F3.pdb.gz
9	AFDB:B8JJL4	0.300	0.306	3.171E-14	600	0.179	0.183	B8JJL4.pdb.gz
10	AFDB:A0A0S2Z4M5	0.254	0.303	3.320E-14	508	0.199	0.240	A0A0S2Z4M5.pdb.gz	A0A0S2Z4M5_HUMAN Retinoid X receptor beta isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=1
11	PDB:3dzyA	0.284	0.554	1.104E-13	302	0.163	0.331	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.284	0.713	4.957E-12	238	0.098	0.252	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.282	0.681	2.253E-7	246	0.080	0.199	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.253	0.567	2.772E-5	259	0.070	0.166	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:6xz6A	0.060	0.139	4.006E-1	213	0.039	0.113	6xz6A.pdb.gz
16	PDB:1yo7A	0.056	0.202	9.570E-1	120	0.033	0.167	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
17	PDB:4q25A	0.100	0.204	1.098	211	0.034	0.100	4q25A.pdb.gz
18	PDB:1rx0A	0.065	0.088	1.150	384	0.046	0.073	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
19	PDB:1ggqA	0.067	0.177	1.381	162	0.031	0.117	1ggqA.pdb.gz
20	PDB:1jqiA	0.063	0.088	1.381	384	0.026	0.042	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1D8S3	0.0	1265	614	1.000	1.000	F1D8S3_HUMAN Nuclear receptor Rev-ErbA-alpha OS=Homo sapiens OX=9606 GN=NR1D1 PE=2 SV=1
2	F1RAU6	0.0	620	637	0.609	0.587	F1RAU6_DANRE Nuclear receptor subfamily 1 group D member 1 OS=Danio rerio OX=7955 GN=Eip75B PE=3 SV=1
3	P20393	0.0	1265	614	1.000	1.000	NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 OS=Homo sapiens OX=9606 GN=NR1D1 PE=1 SV=1
4	Q3UV55	0.0	1095	615	0.956	0.954	NR1D1_MOUSE Nuclear receptor subfamily 1 group D member 1 OS=Mus musculus OX=10090 GN=Nr1d1 PE=1 SV=1
5	Q63503	0.0	1087	615	0.948	0.946	NR1D1_RAT Nuclear receptor subfamily 1 group D member 1 OS=Rattus norvegicus OX=10116 GN=Nr1d1 PE=1 SV=2
6	F1D8P2	2.50e-175	511	579	0.511	0.542	F1D8P2_HUMAN Nuclear receptor Rev-ErbA beta variant 1 OS=Homo sapiens OX=9606 GN=NR1D2 PE=2 SV=1
7	Q14995	2.50e-175	511	579	0.511	0.542	NR1D2_HUMAN Nuclear receptor subfamily 1 group D member 2 OS=Homo sapiens OX=9606 GN=NR1D2 PE=1 SV=4
8	F1QIC9	2.66e-77	256	504	0.202	0.246	F1QIC9_DANRE Nuclear receptor subfamily 1, group D, member 2a OS=Danio rerio OX=7955 GN=NR1D2-A PE=3 SV=2
9	Q6NSM0	2.29e-69	232	408	0.248	0.373	Q6NSM0_HUMAN NR1D2 protein OS=Homo sapiens OX=9606 GN=NR1D2 PE=1 SV=1
10	P17671	2.04e-47	181	1199	0.125	0.064	E75BC_DROME Ecdysone-induced protein 75B, isoforms C/D OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
11	P13055	2.33e-47	181	1412	0.125	0.055	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
12	E9PFX5	3.79e-38	143	248	0.098	0.242	E9PFX5_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=2
13	A0A494C0D9	4.93e-37	144	376	0.098	0.160	A0A494C0D9_HUMAN Peroxisome proliferator-activated receptor gamma (Fragment) OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
14	A0A494C0T3	7.73e-37	143	371	0.098	0.162	A0A494C0T3_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
15	P37231	9.19e-37	145	505	0.098	0.119	PPARG_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=3
16	O62807	1.13e-36	145	504	0.098	0.119	PPARG_PIG Peroxisome proliferator-activated receptor gamma OS=Sus scrofa OX=9823 GN=PPARG PE=2 SV=1
17	E9PFV2	1.15e-36	145	475	0.098	0.126	E9PFV2_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=2
18	O88275	1.35e-36	145	505	0.098	0.119	PPARG_RAT Peroxisome proliferator-activated receptor gamma OS=Rattus norvegicus OX=10116 GN=Pparg PE=1 SV=2
19	P37238	1.43e-36	145	505	0.098	0.119	PPARG_MOUSE Peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Pparg PE=1 SV=3
20	Q9I8W4	2.08e-36	144	468	0.127	0.167	Q9I8W4_CHICK Peroxisome proliferator-activated receptor alpha OS=Gallus gallus OX=9031 GN=PPARalpha PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	3.2e-22	90.7	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.6e-27	107.1	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
2	9606.ENSP00000384517	0.993	Aryl hydrocarbon receptor nuclear translocator-like protein 1
3	9606.ENSP00000478187	0.991	Cryptochrome-2
4	9606.ENSP00000308741	0.990	Circadian locomoter output cycles protein kaput
5	9606.ENSP00000338283	0.988	Neuronal PAS domain-containing protein 2
6	9606.ENSP00000242728	0.983	Class E basic helix-loop-helix protein 41
7	9606.ENSP00000302967	0.956	Histone deacetylase 3
8	9606.ENSP00000264867	0.955	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
9	9606.ENSP00000254657	0.945	Period circadian protein homolog 2
10	9606.ENSP00000263253	0.941	Histone acetyltransferase p300
11	9606.ENSP00000357440	0.936	Heat shock factor protein 2
12	9606.ENSP00000383063	0.935	Nuclear receptor-interacting protein 1
13	9606.ENSP00000261523	0.926	Nuclear receptor ROR-alpha
14	9606.ENSP00000482093	0.924	Period circadian protein homolog 3
15	9606.ENSP00000260402	0.922	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
16	9606.ENSP00000341905	0.922	RAS protein activator like-3
17	9606.ENSP00000008527	0.921	Cryptochrome-1
18	9606.ENSP00000347710	0.890	Oligophrenin-1
19	9606.ENSP00000222122	0.889	D site-binding protein
20	9606.ENSP00000384018	0.857	Nuclear receptor corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.996	protein binding
GO:0000977	0.946	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.842	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0098531	0.722	ligand-activated transcription factor activity
GO:0038023	0.694	signaling receptor activity
GO:0004879	0.596	nuclear receptor activity
GO:0001227	0.558	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008134	0.364	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0009889	0.994	regulation of biosynthetic process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0006355	0.969	regulation of DNA-templated transcription
GO:0009987	0.968	cellular process
GO:0048518	0.900	positive regulation of biological process
GO:0050896	0.886	response to stimulus
GO:0048519	0.805	negative regulation of biological process
GO:0042752	0.650	regulation of circadian rhythm
GO:0048522	0.646	positive regulation of cellular process
GO:0048523	0.610	negative regulation of cellular process
GO:0009893	0.576	positive regulation of metabolic process
GO:0008152	0.554	metabolic process
GO:0010604	0.517	positive regulation of macromolecule metabolic process
GO:0051173	0.469	positive regulation of nitrogen compound metabolic process
GO:0006357	0.456	regulation of transcription by RNA polymerase II
GO:0009892	0.448	negative regulation of metabolic process
GO:0031325	0.438	positive regulation of cellular metabolic process
GO:0051716	0.437	cellular response to stimulus
GO:0009891	0.434	positive regulation of biosynthetic process
GO:0071704	0.428	organic substance metabolic process
GO:0010605	0.428	negative regulation of macromolecule metabolic process
GO:0045935	0.412	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.406	positive regulation of cellular biosynthetic process
GO:0010557	0.405	positive regulation of macromolecule biosynthetic process
GO:0044237	0.403	cellular metabolic process
GO:0045893	0.400	positive regulation of DNA-templated transcription
GO:0051239	0.386	regulation of multicellular organismal process
GO:0048583	0.384	regulation of response to stimulus
GO:0048511	0.375	rhythmic process
GO:0051172	0.360	negative regulation of nitrogen compound metabolic process
GO:0031324	0.357	negative regulation of cellular metabolic process
GO:0044238	0.343	primary metabolic process
GO:0031327	0.306	negative regulation of cellular biosynthetic process
GO:0045934	0.304	negative regulation of nucleobase-containing compound metabolic process
GO:0042221	0.303	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005737	0.937	cytoplasm
GO:0000785	0.435	chromatin
GO:0016604	0.364	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]