StarFunc result for job id P20585

User Input

>input (1137 residues)
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAA
AAPPAPPAPAFPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSE
PKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNA
VSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMK
QQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAK
GYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKLDDAVNVDEIM
TDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDT
VDIKGSQIISGIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGT
TLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEV
LHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAVN
SHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEIQ
GVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRF
HSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMG
GKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTA
EIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKN
YSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPG
EILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQKWTEEFNMEETQTSLLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20585	1.000	1.000	0.000	1137	1.000	1.000	P20585.pdb.gz	MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4
2	AFDB:Q03834	0.686	0.630	1.032E-62	1242	0.234	0.214	Q03834.pdb.gz	MSH6_YEAST DNA mismatch repair protein MSH6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH6 PE=1 SV=1
3	AFDB:O74502	0.674	0.613	2.438E-62	1254	0.252	0.229	O74502.pdb.gz	MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh6 PE=1 SV=1
4	PDB:1ng9A	0.593	0.823	7.032E-53	794	0.199	0.285	1ng9A.pdb.gz	The alternating ATPase domains of MutS control DNA mismatch repair
5	AFDB:P43247	0.592	0.704	2.085E-50	935	0.187	0.228	P43247.pdb.gz	MSH2_MOUSE DNA mismatch repair protein Msh2 OS=Mus musculus OX=10090 GN=Msh2 PE=1 SV=1
6	AFDB:O24617	0.566	0.672	2.624E-49	937	0.179	0.217	O24617.pdb.gz	MSH2_ARATH DNA mismatch repair protein MSH2 OS=Arabidopsis thaliana OX=3702 GN=MSH2 PE=1 SV=1
7	AFDB:B2GSY7	0.564	0.668	8.262E-49	936	0.179	0.217	B2GSY7.pdb.gz
8	PDB:7ou2A	0.549	0.833	9.034E-49	721	0.194	0.307	7ou2A.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
9	PDB:3thwA	0.585	0.729	6.601E-46	890	0.186	0.238	3thwA.pdb.gz	Mechanism of mismatch recognition revealed by human MutSbeta bound to unpaired DNA loops
10	PDB:7ou2B	0.495	0.832	5.617E-44	650	0.179	0.312	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
11	AFDB:Q5BJY1	0.210	0.852	1.213E-27	265	0.185	0.792	Q5BJY1.pdb.gz	Q5BJY1_RAT Msh3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Msh3 PE=2 SV=1
12	PDB:7vwcA	0.129	0.206	1.656E-4	617	0.075	0.138	7vwcA.pdb.gz
13	PDB:6tqeA	0.133	0.211	2.206E-4	634	0.066	0.118	6tqeA.pdb.gz	A mycobacterial ABC transporter mediates the uptake of hydrophilic compounds.
14	PDB:7rr9A	0.120	0.200	2.671E-4	560	0.069	0.139	7rr9A.pdb.gz	Structures of the human peroxisomal fatty acid transporter ABCD1 in a lipid environment
15	PDB:7vgfA	0.154	0.272	2.671E-4	550	0.070	0.145	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
16	PDB:5nbdA	0.112	0.184	2.802E-4	564	0.069	0.138	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
17	PDB:6qexA	0.111	0.108	4.518E-4	1182	0.069	0.067	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
18	AFDB:Q586D9	0.058	0.040	2.744E-1	2060	0.072	0.040	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1
19	AFDB:P22670	0.070	0.077	3.833E-1	979	0.094	0.109	P22670.pdb.gz	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
20	AFDB:Q13009	0.059	0.048	7.134E-1	1591	0.056	0.040	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O65607	0.0	622	1081	0.325	0.341	MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana OX=3702 GN=MSH3 PE=1 SV=2
2	P13705	0.0	1807	1091	0.783	0.816	MSH3_MOUSE DNA mismatch repair protein Msh3 OS=Mus musculus OX=10090 GN=Msh3 PE=2 SV=3
3	P20585	0.0	2361	1137	1.000	1.000	MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4
4	P26359	0.0	604	993	0.307	0.351	MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh3 PE=3 SV=1
5	Q5BJY1	1.43e-143	434	265	0.186	0.796	Q5BJY1_RAT Msh3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Msh3 PE=2 SV=1
6	P25336	3.69e-141	454	1018	0.278	0.310	MSH3_YEAST DNA mismatch repair protein MSH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH3 PE=1 SV=2
7	O74502	5.70e-104	358	1254	0.223	0.202	MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh6 PE=1 SV=1
8	Q38F29	1.73e-103	350	935	0.235	0.286	Q38F29_TRYB2 Mismatch repair protein MSH3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3760 PE=4 SV=1
9	O04716	3.86e-95	333	1324	0.242	0.208	MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana OX=3702 GN=MSH6 PE=1 SV=2
10	E1BYJ2	3.57e-94	331	1337	0.242	0.206	MSH6_CHICK DNA mismatch repair protein Msh6 OS=Gallus gallus OX=9031 GN=MSH6 PE=3 SV=2
11	Q03834	1.08e-86	308	1242	0.219	0.200	MSH6_YEAST DNA mismatch repair protein MSH6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH6 PE=1 SV=1
12	P52701	9.21e-85	303	1360	0.230	0.193	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
13	A0A494C0M1	1.28e-84	302	1261	0.230	0.208	A0A494C0M1_HUMAN DNA mismatch repair protein OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=1
14	P54276	3.05e-82	296	1358	0.235	0.197	MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3
15	A0A1W2Q695	7.99e-82	295	1361	0.230	0.193	A0A1W2Q695_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=2
16	D4A0U9	2.80e-81	293	1336	0.231	0.197	D4A0U9_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=4
17	Q803S7	9.87e-79	286	1369	0.237	0.197	Q803S7_DANRE DNA mismatch repair protein OS=Danio rerio OX=7955 GN=wu:fb36c12 PE=1 SV=1
18	P23909	9.40e-75	268	853	0.215	0.286	MUTS_ECOLI DNA mismatch repair protein MutS OS=Escherichia coli (strain K12) OX=83333 GN=mutS PE=1 SV=1
19	O15457	8.03e-67	246	936	0.172	0.208	MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens OX=9606 GN=MSH4 PE=1 SV=2
20	P25846	1.17e-66	246	959	0.223	0.265	MSH1_YEAST DNA mismatch repair protein MSH1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSH1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01624 MutS_I	4.9e-29	112.2	MutS domain I
2	PF05188 MutS_II	2.4e-30	117.0	MutS domain II
3	PF05192 MutS_III	5.1e-35	133.0	MutS domain III
4	PF05190 MutS_IV	24	16.7	MutS family domain IV
5	PF00488 MutS_V	1.2e-69	245.6	MutS domain V
6	PF05531 NPV_P10	2.3e+02	13.7	Nucleopolyhedrovirus P10 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.999	DNA mismatch repair protein Mlh1
2	9606.ENSP00000233146	0.999	DNA mismatch repair protein Msh2
3	9606.ENSP00000265849	0.996	Mismatch repair endonuclease PMS2
4	9606.ENSP00000355506	0.993	Exonuclease 1
5	9606.ENSP00000234420	0.992	DNA mismatch repair protein Msh6
6	9606.ENSP00000348020	0.982	DNA mismatch repair protein Mlh3
7	9606.ENSP00000406490	0.979	PMS1 protein homolog 1
8	9606.ENSP00000368458	0.977	Proliferating cell nuclear antigen
9	9606.ENSP00000013807	0.971	DNA excision repair protein ERCC-1
10	9606.ENSP00000254719	0.968	Replication protein A 70 kDa DNA-binding subunit
11	9606.ENSP00000406046	0.963	DNA polymerase delta catalytic subunit
12	9606.ENSP00000364270	0.952	DNA repair protein complementing XP-A cells
13	9606.ENSP00000310520	0.941	DNA repair endonuclease XPF
14	9606.ENSP00000223129	0.939	Replication protein A 14 kDa subunit
15	9606.ENSP00000363017	0.934	Replication protein A 32 kDa subunit
16	9606.ENSP00000278616	0.932	Serine-protein kinase ATM
17	9606.ENSP00000347978	0.926	DNA repair protein complementing XP-G cells
18	9606.ENSP00000352257	0.918	X-ray repair cross-complementing protein 6
19	9606.ENSP00000351284	0.914	DNA repair protein RAD52 homolog
20	9606.ENSP00000313420	0.910	DNA-dependent protein kinase catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003697	0.997	single-stranded DNA binding
GO:0030983	0.997	mismatched DNA binding
GO:0019899	0.995	enzyme binding
GO:0032135	0.912	DNA insertion or deletion binding
GO:0003824	0.877	catalytic activity
GO:0032138	0.781	single base insertion or deletion binding
GO:0003684	0.679	damaged DNA binding
GO:0032142	0.641	single guanine insertion binding
GO:0032139	0.640	dinucleotide insertion or deletion binding
GO:0016787	0.633	hydrolase activity
GO:0032181	0.632	dinucleotide repeat insertion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006281	0.997	DNA repair
GO:0006298	0.990	mismatch repair
GO:0050789	0.985	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051052	0.953	regulation of DNA metabolic process
GO:0048519	0.919	negative regulation of biological process
GO:0048523	0.899	negative regulation of cellular process
GO:0009892	0.861	negative regulation of metabolic process
GO:0010605	0.853	negative regulation of macromolecule metabolic process
GO:0071840	0.848	cellular component organization or biogenesis
GO:0016043	0.838	cellular component organization
GO:0031324	0.751	negative regulation of cellular metabolic process
GO:0051172	0.742	negative regulation of nitrogen compound metabolic process
GO:0006996	0.729	organelle organization
GO:0051276	0.721	chromosome organization
GO:0045934	0.654	negative regulation of nucleobase-containing compound metabolic process
GO:0051053	0.643	negative regulation of DNA metabolic process
GO:0000018	0.412	regulation of DNA recombination
GO:0065009	0.352	regulation of molecular function
GO:0006310	0.314	DNA recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0140513	0.996	nuclear protein-containing complex
GO:0032300	0.990	mismatch repair complex
GO:0016020	0.985	membrane
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0005694	0.648	chromosome
GO:0032302	0.372	MutSbeta complex
GO:0005737	0.325	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.633	Hydrolases.

[back to server]