StarFunc result for job id P20594

User Input

>input (1047 residues)
MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFSAKNDHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGERKGPPGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KGK2	0.389	0.388	0.000	1051	0.655	0.653	A0A0G2KGK2.pdb.gz
2	AFDB:E7F3T9	0.569	0.561	0.000	1065	0.557	0.547	E7F3T9.pdb.gz
3	AFDB:P16066	0.679	0.671	0.000	1061	0.612	0.604	P16066.pdb.gz	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
4	AFDB:P16067	0.573	0.573	0.000	1047	0.985	0.985	P16067.pdb.gz	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
5	AFDB:Q1LX84	0.567	0.558	0.000	1067	0.585	0.574	Q1LX84.pdb.gz	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
6	AFDB:Q86GV3	0.360	0.298	4.349E-104	1276	0.440	0.361	Q86GV3.pdb.gz	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
7	AFDB:Q9VU79	0.530	0.460	6.202E-94	1250	0.394	0.330	Q9VU79.pdb.gz	Q9VU79_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
8	AFDB:P55205	0.454	0.434	3.697E-90	1100	0.337	0.321	P55205.pdb.gz	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
9	AFDB:Q6TL19	0.456	0.435	6.578E-90	1100	0.337	0.321	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
10	AFDB:Q7JQ32	0.495	0.375	2.571E-88	1525	0.367	0.252	Q7JQ32.pdb.gz	GC76C_DROME Receptor-type guanylate cyclase Gyc76C OS=Drosophila melanogaster OX=7227 GN=Gyc76C PE=1 SV=1
11	PDB:7d9rA	0.218	0.446	3.212E-21	502	0.095	0.197	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
12	PDB:7c7sA	0.323	0.480	1.253E-20	685	0.086	0.131	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
13	PDB:6jt0A	0.210	0.398	5.723E-20	542	0.095	0.183	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
14	PDB:6jt0B	0.215	0.379	2.613E-19	576	0.100	0.182	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:7d9tA	0.204	0.409	2.613E-19	512	0.099	0.203	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
16	PDB:6w2xB	0.318	0.480	3.222E-19	669	0.085	0.133	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
17	PDB:7yziA	0.211	0.538	3.980E-18	378	0.100	0.278	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
18	PDB:7e9gR	0.273	0.354	1.331E-15	769	0.061	0.083	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
19	PDB:7ks0A	0.286	0.390	2.630E-15	741	0.061	0.086	7ks0A.pdb.gz
20	PDB:4pe5C	0.266	0.358	4.679E-15	754	0.053	0.074	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C7LAF5	0.0	635	1237	0.402	0.340	C7LAF5_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=CG10738-RA PE=2 SV=1
2	M9NFA6	0.0	637	1235	0.402	0.341	M9NFA6_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10738 PE=3 SV=1
3	P16066	0.0	1261	1061	0.612	0.604	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
4	P16067	0.0	2143	1047	0.986	0.986	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
5	P18293	0.0	1277	1057	0.615	0.609	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
6	P18910	0.0	1283	1057	0.618	0.612	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
7	P20594	0.0	2168	1047	1.000	1.000	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
8	Q1LX84	0.0	1248	1067	0.585	0.575	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
9	Q6VVW5	0.0	2147	1047	0.987	0.987	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
10	Q7JQ32	0.0	574	1525	0.326	0.224	GC76C_DROME Receptor-type guanylate cyclase Gyc76C OS=Drosophila melanogaster OX=7227 GN=Gyc76C PE=1 SV=1
11	Q86GV3	0.0	626	1276	0.316	0.259	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
12	Q8IQK2	0.0	629	1248	0.399	0.335	Q8IQK2_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
13	Q9VU79	0.0	628	1250	0.399	0.334	Q9VU79_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
14	P55205	2.09e-175	544	1100	0.344	0.327	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
15	Q6TL19	5.12e-169	527	1100	0.362	0.345	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
16	O02740	2.64e-164	515	1103	0.337	0.320	GUC2F_BOVIN Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 GN=GUCY2F PE=1 SV=1
17	P51842	2.23e-163	513	1108	0.353	0.334	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
18	P51840	1.27e-162	511	1108	0.344	0.325	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
19	Q5SDA5	2.76e-162	509	1108	0.355	0.336	GUC2F_MOUSE Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1
20	Q9XTY1	1.25e-161	506	1058	0.317	0.314	GCY22_CAEEL Receptor-type guanylate cyclase gcy-22 OS=Caenorhabditis elegans OX=6239 GN=gcy-22 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	1.1e-43	161.4	Receptor family ligand binding region
2	PF00211 Guanylate_cyc	7.8e-66	232.7	Adenylate and Guanylate cyclase catalytic domain
3	PF07701 HNOBA	1.3	19.9	Heme NO binding associated
4	PF00069 Pkinase	6e-29	112.8	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.5e-35	134.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010374484.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352871.1	0.999	C-type natriuretic peptide
2	61622.XP_010355675.1	0.989	Natriuretic peptides A
3	61622.XP_010363170.1	0.973	Phosphodiesterase 5A
4	61622.XP_010373611.1	0.971	Phosphodiesterase 6B
5	61622.XP_010381502.1	0.961	Phosphodiesterase 9A
6	61622.XP_010358503.1	0.960	Phosphodiesterase 6A
7	61622.XP_010356224.1	0.955	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 ESTs, 15 Proteins
8	61622.XP_010377274.1	0.901	Inosine triphosphate pyrophosphatase isoform X1
9	61622.XP_010384073.1	0.900	Nudix hydrolase 2
10	61622.XP_010385172.1	0.890	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha-like
11	61622.XP_010377847.1	0.877	Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'-like
12	61622.XP_010355669.1	0.868	Natriuretic peptides B
13	61622.XP_010365186.1	0.843	Phosphodiesterase 2A
14	61622.XP_010380758.1	0.829	Phosphodiesterase 11A
15	61622.XP_010370345.1	0.807	GTP cyclohydrolase 1 isoform X1
16	61622.XP_010371446.1	0.807	Phosphodiesterase 10A
17	61622.XP_010363059.1	0.805	Natriuretic peptide receptor 1
18	61622.XP_010388036.1	0.804	Molybdenum cofactor synthesis 1
19	61622.XP_010359655.1	0.763	Phosphodiesterase 3A
20	61622.XP_010366996.1	0.739	Phosphodiesterase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004383	1.000	guanylate cyclase activity
GO:0038023	0.998	signaling receptor activity
GO:0005515	0.998	protein binding
GO:0017046	0.996	peptide hormone binding
GO:0001653	0.986	peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0050896	0.981	response to stimulus
GO:0009987	0.981	cellular process
GO:0050794	0.973	regulation of cellular process
GO:0023052	0.972	signaling
GO:0007165	0.960	signal transduction
GO:0032501	0.957	multicellular organismal process
GO:0019693	0.930	ribose phosphate metabolic process
GO:0003013	0.918	circulatory system process
GO:0052652	0.893	cyclic purine nucleotide metabolic process
GO:0065008	0.726	regulation of biological quality
GO:0048518	0.698	positive regulation of biological process
GO:0007166	0.686	cell surface receptor signaling pathway
GO:0019935	0.601	cyclic-nucleotide-mediated signaling
GO:0048522	0.599	positive regulation of cellular process
GO:0010646	0.540	regulation of cell communication
GO:0023051	0.531	regulation of signaling
GO:0009259	0.521	ribonucleotide metabolic process
GO:0009150	0.508	purine ribonucleotide metabolic process
GO:0007167	0.500	enzyme-linked receptor protein signaling pathway
GO:0009058	0.397	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.860	organelle
GO:0005622	0.801	intracellular anatomical structure
GO:0043227	0.787	membrane-bounded organelle
GO:0005737	0.671	cytoplasm
GO:0043229	0.485	intracellular organelle
GO:0043231	0.443	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	1.000	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	1.000	guanylate cyclase.

[back to server]