StarFunc result for job id P20648

User Input

>input (1035 residues)
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3ixzA	0.927	0.961	0.000	998	0.945	0.980	3ixzA.pdb.gz
2	PDB:7x20A	0.933	0.978	0.000	986	0.625	0.656	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
3	AFDB:A2VDL6	0.968	0.982	0.000	1020	0.624	0.633	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
4	AFDB:A8QI34	0.956	0.980	0.000	1009	0.527	0.540	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
5	AFDB:B0S5Q5	0.963	0.980	0.000	1017	0.620	0.631	B0S5Q5.pdb.gz
6	AFDB:B8JKS9	0.961	0.972	0.000	1023	0.606	0.613	B8JKS9.pdb.gz
7	AFDB:C0H8U1	0.959	0.966	0.000	1028	0.605	0.609	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
8	AFDB:E1B8N5	0.952	0.957	0.000	1030	0.611	0.614	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
9	AFDB:P13607	0.950	0.944	0.000	1041	0.600	0.597	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
10	AFDB:P20648	1.000	1.000	0.000	1035	1.000	1.000	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
11	AFDB:P54707	0.962	0.958	0.000	1039	0.641	0.638	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
12	AFDB:P54708	0.971	0.970	0.000	1036	0.638	0.637	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
13	PDB:8d3xA	0.940	0.983	1.097E-103	989	0.626	0.655	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
14	PDB:3b8eA	0.931	0.965	4.720E-95	998	0.614	0.636	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
15	PDB:7e7sA	0.567	0.574	3.341E-55	1020	0.272	0.276	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.569	0.586	4.609E-53	1000	0.271	0.281	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.542	0.602	1.204E-37	911	0.220	0.250	6a69A.pdb.gz
18	PDB:7vpkA	0.695	0.683	1.732E-35	1055	0.191	0.188	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7m5xA	0.630	0.651	8.696E-34	1000	0.187	0.194	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
20	PDB:7vh5A	0.488	0.607	2.526E-32	804	0.194	0.250	7vh5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1183	875	0.548	0.648	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1158	876	0.526	0.621	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	680	517	0.310	0.621	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1317	992	0.606	0.632	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	687	534	0.316	0.612	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	810	639	0.379	0.613	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	843	661	0.392	0.614	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	1362	1020	0.618	0.627	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1102	1009	0.526	0.539	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1283	1028	0.595	0.599	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	699	524	0.319	0.630	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1289	1030	0.593	0.596	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1309	988	0.613	0.642	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	1357	1023	0.622	0.630	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	1358	1021	0.618	0.627	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	1348	1023	0.616	0.624	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	1352	1020	0.615	0.625	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	1373	1013	0.628	0.642	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1327	1021	0.621	0.630	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	2102	1033	0.978	0.980	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.6e-18	77.9	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	2.7e-36	136.5	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	3.8e-11	53.9	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	4.9e-42	155.0	E1-E2 ATPase
5	PF09040 H-K_ATPase_N	2e-18	77.9	Gastric H+/K+-ATPase, N terminal domain
6	PF12710 HAD	3e+02	13.3	haloacid dehalogenase-like hydrolase
7	PF00702 Hydrolase	1.2e-12	60.1	haloacid dehalogenase-like hydrolase
8	PF08282 Hydrolase_3	0.2	23.0	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334216	0.976	Potassium-transporting ATPase subunit beta
2	9606.ENSP00000362329	0.966	Pyrophosphatase 1
3	9606.ENSP00000343885	0.905	Inorganic pyrophosphatase 2, mitochondrial
4	9606.ENSP00000357835	0.900	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
5	9606.ENSP00000360372	0.891	Cytochrome P450 2C19
6	9606.ENSP00000366506	0.870	Histamine H2 receptor
7	9606.ENSP00000331358	0.864	Gastrin
8	9606.ENSP00000234396	0.836	V-type proton ATPase subunit B, kidney isoform
9	9606.ENSP00000218548	0.806	Potassium-transporting ATPase alpha chain 2
10	9606.ENSP00000264649	0.796	V-type proton ATPase 116 kDa subunit a isoform 1
11	9606.ENSP00000308122	0.787	V-type proton ATPase 116 kDa subunit a isoform 4
12	9606.ENSP00000265686	0.786	V-type proton ATPase 116 kDa subunit a isoform 3
13	9606.ENSP00000285393	0.782	V-type proton ATPase subunit d 2
14	9606.ENSP00000356790	0.744	Sodium/potassium-transporting ATPase subunit beta-1
15	9606.ENSP00000387760	0.743	Angiotensin-converting enzyme
16	9606.ENSP00000216442	0.742	V-type proton ATPase subunit D
17	9606.ENSP00000290866	0.739	Angiotensin-converting enzyme
18	9606.ENSP00000329757	0.732	V-type proton ATPase 16 kDa proteolipid subunit
19	9606.ENSP00000411672	0.720	ATPase H+ transporting V0 subunit e2
20	9606.ENSP00000337915	0.714	Cytochrome P450 3A4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008556	1.000	P-type potassium transmembrane transporter activity
GO:0005515	0.999	protein binding
GO:0008553	0.996	P-type proton-exporting transporter activity
GO:0005391	0.919	P-type sodium:potassium-exchanging transporter activity
GO:0097159	0.408	organic cyclic compound binding
GO:0043167	0.390	ion binding
GO:1901363	0.314	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.976	multicellular organismal process
GO:0051179	0.959	localization
GO:0009987	0.941	cellular process
GO:0006810	0.937	transport
GO:0050789	0.907	regulation of biological process
GO:0050794	0.900	regulation of cellular process
GO:0050896	0.836	response to stimulus
GO:0006811	0.808	monoatomic ion transport
GO:0055085	0.731	transmembrane transport
GO:0042221	0.491	response to chemical
GO:0042592	0.352	homeostatic process
GO:0051716	0.334	cellular response to stimulus
GO:0007586	0.312	digestion
GO:0032879	0.311	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.805	membrane-bounded organelle
GO:0005576	0.752	extracellular region
GO:0031982	0.749	vesicle
GO:0005622	0.720	intracellular anatomical structure
GO:0005737	0.679	cytoplasm
GO:0005615	0.634	extracellular space
GO:0098590	0.507	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16777	1.000	ATP + H2O + K(+)(out) = ADP + H(+) + K(+)(in) + phosphate
EC:7.2.2.6	1.000	P-type K(+) transporter.
RHEA:20852	0.996	ATP + H(+)(in) + H2O = ADP + 2 H(+)(out) + phosphate
EC:7.1.2.1	0.996	P-type H(+)-exporting transporter.
RHEA:18353	0.919	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.919	Na(+)/K(+)-exchanging ATPase.

[back to server]