StarFunc result for job id P20671

User Input

>input (130 residues)
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QV6	0.964	0.957	2.869E-20	131	0.931	0.924	Q96QV6.pdb.gz	H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3
2	AFDB:Q8CGP4	0.947	0.954	5.184E-20	129	0.862	0.868	Q8CGP4.pdb.gz	Q8CGP4_MOUSE Histone H2A OS=Mus musculus OX=10090 GN=H2ac1 PE=1 SV=1
3	AFDB:D3ZXP3	0.827	0.755	1.424E-18	143	0.900	0.818	D3ZXP3.pdb.gz	D3ZXP3_RAT Histone H2A OS=Rattus norvegicus OX=10116 GN=H2ax PE=1 SV=1
4	AFDB:Q7ZUY3	0.831	0.764	1.424E-18	142	0.915	0.838	Q7ZUY3.pdb.gz	H2AX_DANRE Histone H2AX OS=Danio rerio OX=7955 GN=h2ax PE=2 SV=3
5	AFDB:P04911	0.909	0.896	1.519E-17	132	0.723	0.712	P04911.pdb.gz	H2A1_YEAST Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTA1 PE=1 SV=2
6	AFDB:P08844	0.894	0.881	1.924E-17	132	0.808	0.795	P08844.pdb.gz	H2A_EMENI Histone H2A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=htaA PE=3 SV=2
7	AFDB:P04909	0.921	0.907	2.298E-17	132	0.777	0.765	P04909.pdb.gz	H2A1_SCHPO Histone H2A-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hta1 PE=1 SV=3
8	AFDB:Q9C681	0.935	0.922	3.689E-17	132	0.738	0.727	Q9C681.pdb.gz	H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thaliana OX=3702 GN=At1g51060 PE=1 SV=1
9	AFDB:C6KT18	0.881	0.869	2.051E-16	132	0.677	0.667	C6KT18.pdb.gz	C6KT18_PLAF7 Histone H2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0617800 PE=3 SV=1
10	AFDB:O04848	0.830	0.762	9.553E-16	142	0.700	0.641	O04848.pdb.gz	H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis thaliana OX=3702 GN=At1g08880 PE=1 SV=1
11	PDB:2rvqC	0.520	0.509	1.201E-14	133	0.992	0.970	2rvqC.pdb.gz
12	PDB:1id3C	0.789	0.929	1.137E-13	110	0.677	0.800	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
13	PDB:5z30G	0.786	0.923	3.331E-11	110	0.546	0.645	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
14	PDB:7pj1A	0.449	0.470	9.664E-11	123	0.792	0.837	7pj1A.pdb.gz
15	PDB:6m4gC	0.654	0.928	1.249E-6	90	0.331	0.478	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
16	PDB:6a7uA	0.552	0.426	3.881E-4	170	0.300	0.229	6a7uA.pdb.gz
17	PDB:5y26B	0.452	0.601	4.941E-3	92	0.131	0.185	5y26B.pdb.gz
18	PDB:2rvqD	0.404	0.407	5.242E-3	129	0.154	0.155	2rvqD.pdb.gz
19	PDB:1b67A	0.421	0.747	5.562E-3	68	0.138	0.265	1b67A.pdb.gz
20	PDB:1bfmA	0.437	0.746	1.005E-2	69	0.138	0.261	1bfmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20671	8.28e-90	258	130	1.000	1.000	H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens OX=9606 GN=H2AC7 PE=1 SV=2
2	P04908	2.32e-89	256	130	0.992	0.992	H2A1B_HUMAN Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2
3	A4FTV9	2.80e-89	256	130	0.992	0.992	A4FTV9_HUMAN Histone H2A OS=Homo sapiens OX=9606 GN=HIST1H2AK PE=1 SV=1
4	P0C0S8	2.80e-89	256	130	0.992	0.992	H2A1_HUMAN Histone H2A type 1 OS=Homo sapiens OX=9606 GN=H2AC11 PE=1 SV=2
5	Q7L7L0	7.94e-89	255	130	0.985	0.985	H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens OX=9606 GN=H2AC25 PE=1 SV=3
6	Q6FI13	1.44e-88	254	130	0.977	0.977	H2A2A_HUMAN Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=H2AC18 PE=1 SV=3
7	Q93077	2.54e-88	254	130	0.977	0.977	H2A1C_HUMAN Histone H2A type 1-C OS=Homo sapiens OX=9606 GN=H2AC6 PE=1 SV=3
8	Q96KK5	7.78e-88	253	128	0.977	0.992	H2A1H_HUMAN Histone H2A type 1-H OS=Homo sapiens OX=9606 GN=H2AC12 PE=1 SV=3
9	Q99878	2.97e-87	251	128	0.969	0.984	H2A1J_HUMAN Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3
10	Q16777	6.43e-85	245	129	0.962	0.969	H2A2C_HUMAN Histone H2A type 2-C OS=Homo sapiens OX=9606 GN=H2AC20 PE=1 SV=4
11	P70082	2.80e-84	244	129	0.954	0.961	H2AJ_CHICK Histone H2A.J OS=Gallus gallus OX=9031 GN=H2A-IX PE=3 SV=1
12	Q8IUE6	1.69e-83	242	130	0.938	0.938	H2A2B_HUMAN Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=H2AC21 PE=1 SV=3
13	Q96QV6	2.25e-83	241	131	0.931	0.924	H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3
14	Q9BTM1	5.13e-83	241	129	0.923	0.930	H2AJ_HUMAN Histone H2A.J OS=Homo sapiens OX=9606 GN=H2AJ PE=1 SV=1
15	P02264	4.26e-82	238	128	0.931	0.945	H2A_ONCMY Histone H2A OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
16	C1BEH9	4.37e-81	236	128	0.915	0.930	C1BEH9_ONCMY Histone H2A OS=Oncorhynchus mykiss OX=8022 GN=H2A PE=2 SV=1
17	Q7ZUY3	1.10e-79	233	142	0.900	0.824	H2AX_DANRE Histone H2AX OS=Danio rerio OX=7955 GN=h2ax PE=2 SV=3
18	D3ZXP3	4.97e-79	231	143	0.892	0.811	D3ZXP3_RAT Histone H2A OS=Rattus norvegicus OX=10116 GN=H2ax PE=1 SV=1
19	P16104	5.13e-79	231	143	0.892	0.811	H2AX_HUMAN Histone H2AX OS=Homo sapiens OX=9606 GN=H2AX PE=1 SV=2
20	P27661	1.21e-78	230	143	0.885	0.804	H2AX_MOUSE Histone H2AX OS=Mus musculus OX=10090 GN=H2ax PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.6	21.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF00125 Histone	5.7e-12	57.4	Core histone H2A/H2B/H3/H4
3	PF16211 Histone_H2A_C	2.8e-16	70.3	C-terminus of histone H2A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000013270

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000022337	0.978	Cyclin-dependent kinase 2
2	9361.ENSDNOP00000029550	0.969	H1 histone family, member 0
3	9361.ENSDNOP00000021613	0.966	Histone cluster 1, H3b
4	9361.ENSDNOP00000025631	0.966	annotation not available
5	9361.ENSDNOP00000032688	0.964	Histone cluster 2, H2be
6	9361.ENSDNOP00000007737	0.950	CREB binding protein
7	9361.ENSDNOP00000017778	0.948	Cyclin-dependent kinase 1
8	9361.ENSDNOP00000024160	0.947	annotation not available
9	9361.ENSDNOP00000026853	0.947	Histone cluster 1, H4l
10	9361.ENSDNOP00000028890	0.947	Histone cluster 1, H4i
11	9361.ENSDNOP00000029265	0.947	annotation not available
12	9361.ENSDNOP00000029778	0.947	Histone cluster 1, H4f
13	9361.ENSDNOP00000030816	0.947	Histone cluster 1, H4k
14	9361.ENSDNOP00000033936	0.947	annotation not available
15	9361.ENSDNOP00000034392	0.947	annotation not available
16	9361.ENSDNOP00000014582	0.944	Hemochromatosis
17	9361.ENSDNOP00000016449	0.944	annotation not available
18	9361.ENSDNOP00000016532	0.944	annotation not available
19	9361.ENSDNOP00000019318	0.944	Histone cluster 3, H3
20	9361.ENSDNOP00000019564	0.944	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.575	heterocyclic compound binding
GO:0097159	0.575	organic cyclic compound binding
GO:0003676	0.574	nucleic acid binding
GO:0003690	0.563	double-stranded DNA binding
GO:0043565	0.549	sequence-specific DNA binding
GO:1990837	0.438	sequence-specific double-stranded DNA binding
GO:0000976	0.351	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.965	regulation of cellular process
GO:0050896	0.954	response to stimulus
GO:0006950	0.902	response to stress
GO:0008152	0.773	metabolic process
GO:0071704	0.735	organic substance metabolic process
GO:0044238	0.733	primary metabolic process
GO:0048523	0.725	negative regulation of cellular process
GO:0006807	0.700	nitrogen compound metabolic process
GO:0043170	0.666	macromolecule metabolic process
GO:0071840	0.562	cellular component organization or biogenesis
GO:0019222	0.562	regulation of metabolic process
GO:0060255	0.529	regulation of macromolecule metabolic process
GO:0016043	0.514	cellular component organization
GO:0044237	0.508	cellular metabolic process
GO:0042127	0.430	regulation of cell population proliferation
GO:0051171	0.429	regulation of nitrogen compound metabolic process
GO:0031323	0.429	regulation of cellular metabolic process
GO:0080090	0.428	regulation of primary metabolic process
GO:0051716	0.417	cellular response to stimulus
GO:0006325	0.407	chromatin organization
GO:0010468	0.387	regulation of gene expression
GO:0019219	0.387	regulation of nucleobase-containing compound metabolic process
GO:0034641	0.349	cellular nitrogen compound metabolic process
GO:0031326	0.317	regulation of cellular biosynthetic process
GO:0010556	0.316	regulation of macromolecule biosynthetic process
GO:0090304	0.308	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005576	0.979	extracellular region
GO:0031981	0.958	nuclear lumen
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0032991	0.939	protein-containing complex
GO:0005615	0.927	extracellular space
GO:0005654	0.920	nucleoplasm
GO:0031982	0.919	vesicle
GO:0043230	0.905	extracellular organelle
GO:0070062	0.890	extracellular exosome
GO:0005737	0.681	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]