StarFunc result for job id P20701

User Input

>input (1170 residues)
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K4L8	0.691	0.696	0.000	1161	0.334	0.337	A0A0G2K4L8.pdb.gz	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
2	AFDB:F1LP44	0.868	0.874	0.000	1161	0.720	0.725	F1LP44.pdb.gz	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
3	AFDB:P05555	0.685	0.694	0.000	1153	0.324	0.329	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
4	AFDB:P11215	0.491	0.498	0.000	1152	0.326	0.331	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
5	AFDB:P20701	1.000	1.000	0.000	1170	1.000	1.000	P20701.pdb.gz	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
6	AFDB:P24063	0.900	0.905	0.000	1163	0.711	0.715	P24063.pdb.gz	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
7	AFDB:P61625	0.905	0.909	0.000	1165	0.770	0.773	P61625.pdb.gz	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
8	AFDB:Q13349	0.486	0.489	0.000	1161	0.326	0.329	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
9	AFDB:Q3V0T4	0.695	0.696	0.000	1168	0.310	0.311	Q3V0T4.pdb.gz	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
10	AFDB:Q9QXH4	0.497	0.498	0.000	1169	0.339	0.340	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
11	PDB:4nehA	0.662	0.709	1.738E-96	1084	0.309	0.333	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.592	0.643	4.306E-95	1063	0.303	0.334	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.611	0.811	4.911E-77	856	0.248	0.339	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:3k6sC	0.589	0.756	1.197E-68	885	0.256	0.339	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
15	PDB:3fcsA	0.555	0.689	7.477E-52	913	0.171	0.219	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:4g1eA	0.544	0.645	1.871E-51	964	0.181	0.220	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7nxdA	0.412	0.520	6.233E-49	905	0.183	0.236	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:7sqcO0	0.108	0.110	2.054E-8	1140	0.057	0.059	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:4rtdA	0.084	0.087	7.341E-8	1122	0.044	0.046	4rtdA.pdb.gz
20	PDB:1f13A	0.104	0.137	9.966E-8	722	0.036	0.058	1f13A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4L8	0.0	565	1151	0.341	0.347	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
2	A0A8I5ZT41	0.0	1399	1079	0.635	0.689	A0A8I5ZT41_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=1
3	F1LP44	0.0	1659	1161	0.720	0.725	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
4	G3V8L7	0.0	565	1151	0.340	0.346	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
5	P05555	0.0	570	1153	0.344	0.349	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
6	P11215	0.0	570	1152	0.338	0.344	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
7	P20701	0.0	2418	1170	1.000	1.000	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
8	P24063	0.0	1689	1162	0.716	0.721	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
9	P61625	0.0	1793	1165	0.771	0.774	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
10	Q3T1L6	0.0	1658	1160	0.720	0.726	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
11	Q9JI30	0.0	565	1151	0.343	0.348	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
12	Q9QXH4	0.0	590	1169	0.357	0.358	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
13	A0A8I5Y8A4	1.13e-179	560	1141	0.335	0.344	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
14	Q9QYE7	6.86e-177	553	1161	0.345	0.348	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
15	Q3V0T4	3.06e-174	546	1168	0.336	0.336	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
16	P20702	1.76e-173	544	1163	0.352	0.354	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
17	Q13349	3.06e-170	536	1161	0.340	0.343	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
18	A0A8I5ZVY4	2.43e-159	505	1088	0.272	0.292	A0A8I5ZVY4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
19	Q9UKX5	1.24e-116	392	1188	0.266	0.262	ITA11_HUMAN Integrin alpha-11 OS=Homo sapiens OX=9606 GN=ITGA11 PE=1 SV=2
20	P61622	4.69e-113	382	1188	0.259	0.255	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	2.7e-18	76.7	FG-GAP repeat
2	PF14312 FG-GAP_2	0.14	23.7	FG-GAP repeat
3	PF13517 FG-GAP_3	3.2e-05	35.7	FG-GAP-like repeat
4	PF18698 HisK_sensor	14	17.5	Histidine kinase sensor domain
5	PF00357 Integrin_alpha	0.34	22.0	Integrin alpha cytoplasmic region
6	PF08441 Integrin_alpha2	6e-35	132.8	Integrin alpha
7	PF00092 VWA	4.5e-28	110.2	von Willebrand factor type A domain
8	PF13519 VWA_2	7.7e-07	41.1	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000160262	0.999	Intercellular adhesion molecule 3
2	9606.ENSP00000264832	0.999	Intercellular adhesion molecule 1
3	9606.ENSP00000380948	0.999	Integrin beta-2
4	9606.ENSP00000415283	0.998	Intercellular adhesion molecule 2
5	9606.ENSP00000221980	0.995	Intercellular adhesion molecule 5
6	9606.ENSP00000357005	0.990	Junctional adhesion molecule A
7	9606.ENSP00000379350	0.976	Integrin beta-1
8	9606.ENSP00000452786	0.974	Integrin beta-3
9	9606.ENSP00000342114	0.973	Intercellular adhesion molecule 4
10	9606.ENSP00000267082	0.969	Integrin beta-7
11	9606.ENSP00000324890	0.966	T-cell-specific surface glycoprotein CD28
12	9606.ENSP00000303939	0.964	Cytotoxic T-lymphocyte protein 4
13	9606.ENSP00000264246	0.962	T-lymphocyte activation antigen CD80
14	9606.ENSP00000294728	0.951	Vascular cell adhesion protein 1
15	9606.ENSP00000296181	0.951	Integrin beta-5
16	9606.ENSP00000283249	0.950	Integrin beta-6
17	9606.ENSP00000222573	0.948	Integrin beta-8
18	9606.ENSP00000299106	0.946	Junctional adhesion molecule C
19	9606.ENSP00000411355	0.946	Receptor-type tyrosine-protein phosphatase C
20	9606.ENSP00000380227	0.939	Integrin alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.995	protein-containing complex binding
GO:0004888	0.972	transmembrane signaling receptor activity
GO:0050839	0.923	cell adhesion molecule binding
GO:0005102	0.345	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007155	0.989	cell adhesion
GO:0098609	0.977	cell-cell adhesion
GO:0050896	0.919	response to stimulus
GO:0065007	0.774	biological regulation
GO:0032501	0.689	multicellular organismal process
GO:0050789	0.680	regulation of biological process
GO:0050794	0.636	regulation of cellular process
GO:0002376	0.614	immune system process
GO:0048518	0.538	positive regulation of biological process
GO:0051716	0.480	cellular response to stimulus
GO:0001775	0.446	cell activation
GO:0048522	0.437	positive regulation of cellular process
GO:0007154	0.433	cell communication
GO:0007165	0.403	signal transduction
GO:0016477	0.341	cell migration
GO:0045321	0.319	leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.998	cell surface
GO:0005886	0.988	plasma membrane
GO:0032991	0.961	protein-containing complex
GO:0043227	0.880	membrane-bounded organelle
GO:0005622	0.851	intracellular anatomical structure
GO:0031982	0.755	vesicle
GO:0008305	0.697	integrin complex
GO:0043231	0.641	intracellular membrane-bounded organelle
GO:0005576	0.593	extracellular region
GO:0005737	0.592	cytoplasm
GO:0012505	0.543	endomembrane system
GO:0031410	0.479	cytoplasmic vesicle
GO:0070062	0.397	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]