StarFunc result for job id P20702

User Input

>input (1163 residues)
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3k6sC	0.702	0.908	0.000	885	0.760	0.999	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
2	PDB:4nehA	0.928	0.995	0.000	1084	0.925	0.993	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
3	PDB:4nenA	0.864	0.942	0.000	1063	0.908	0.993	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
4	PDB:7uslA	0.623	0.822	0.000	856	0.459	0.624	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
5	AFDB:A0A0G2K4L8	0.871	0.872	0.000	1161	0.586	0.587	A0A0G2K4L8.pdb.gz	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
6	AFDB:F1LP44	0.606	0.607	0.000	1161	0.334	0.335	F1LP44.pdb.gz	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
7	AFDB:P05555	0.865	0.872	0.000	1153	0.569	0.574	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
8	AFDB:P11215	0.512	0.517	0.000	1152	0.604	0.609	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
9	AFDB:P20701	0.699	0.695	0.000	1170	0.342	0.340	P20701.pdb.gz	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
10	AFDB:P20702	1.000	1.000	0.000	1163	1.000	1.000	P20702.pdb.gz	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
11	AFDB:P24063	0.642	0.642	0.000	1163	0.328	0.328	P24063.pdb.gz	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
12	AFDB:P61625	0.619	0.618	0.000	1165	0.337	0.336	P61625.pdb.gz	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
13	AFDB:Q13349	0.514	0.515	0.000	1161	0.651	0.652	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
14	AFDB:Q3V0T4	0.895	0.891	0.000	1168	0.610	0.608	Q3V0T4.pdb.gz	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
15	PDB:4g1eA	0.532	0.624	5.122E-59	964	0.192	0.231	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	PDB:3fcsA	0.528	0.651	3.507E-56	913	0.183	0.233	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
17	PDB:7nxdA	0.428	0.538	3.876E-55	905	0.189	0.243	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:5a42A	0.085	0.072	3.893E-9	1597	0.076	0.055	5a42A.pdb.gz
19	PDB:4rtdA	0.085	0.088	8.522E-9	1122	0.059	0.061	4rtdA.pdb.gz
20	PDB:2xwbF	0.142	0.221	1.050E-8	714	0.070	0.113	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4L8	0.0	1335	1151	0.563	0.569	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
2	A0A8I5Y8A4	0.0	1316	1141	0.555	0.565	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
3	A0A8I5ZVY4	0.0	1179	1088	0.527	0.563	A0A8I5ZVY4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
4	A0A8I6A686	0.0	621	1034	0.273	0.307	A0A8I6A686_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
5	G3V8L7	0.0	1329	1151	0.560	0.566	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
6	P05555	0.0	1340	1153	0.568	0.573	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
7	P11215	0.0	1382	1152	0.603	0.609	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
8	P20702	0.0	2409	1163	1.000	1.000	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
9	P61625	0.0	568	1165	0.350	0.349	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
10	Q13349	0.0	1503	1161	0.648	0.649	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
11	Q3V0T4	0.0	1402	1168	0.611	0.609	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
12	Q9JI30	0.0	1331	1151	0.560	0.566	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
13	Q9QXH4	0.0	1698	1169	0.707	0.703	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
14	Q9QYE7	0.0	1403	1161	0.611	0.612	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
15	P24063	5.10e-171	538	1162	0.341	0.342	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
16	P20701	4.56e-170	535	1170	0.358	0.356	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
17	Q3T1L6	1.80e-165	523	1160	0.340	0.341	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
18	F1LP44	2.50e-165	523	1161	0.340	0.340	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
19	A0A8I5ZT41	1.51e-146	471	1079	0.253	0.272	A0A8I5ZT41_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=1
20	Q60677	2.10e-125	416	1167	0.261	0.260	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.8e-19	80.4	FG-GAP repeat
2	PF14312 FG-GAP_2	7.4e+02	11.8	FG-GAP repeat
3	PF13517 FG-GAP_3	0.0094	27.8	FG-GAP-like repeat
4	PF00357 Integrin_alpha	0.017	26.1	Integrin alpha cytoplasmic region
5	PF08441 Integrin_alpha2	8.9e-34	129.0	Integrin alpha
6	PF00092 VWA	1e-38	144.9	von Willebrand factor type A domain
7	PF13519 VWA_2	1.3e-11	56.4	von Willebrand factor type A domain
8	PF05762 VWA_CoxE	0.88	20.5	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380948	0.999	Integrin beta-2
2	9606.ENSP00000264832	0.995	Intercellular adhesion molecule 1
3	9606.ENSP00000294728	0.988	Vascular cell adhesion protein 1
4	9606.ENSP00000264246	0.972	T-lymphocyte activation antigen CD80
5	9606.ENSP00000245907	0.969	Complement C3
6	9606.ENSP00000304915	0.969	Interleukin-13
7	9606.ENSP00000441691	0.954	Integrin alpha-M
8	9606.ENSP00000011653	0.952	T-cell surface glycoprotein CD4
9	9606.ENSP00000411355	0.946	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000264072	0.945	Low affinity immunoglobulin epsilon Fc receptor
11	9606.ENSP00000332049	0.934	T-lymphocyte activation antigen CD86
12	9606.ENSP00000303939	0.927	Cytotoxic T-lymphocyte protein 4
13	9606.ENSP00000324890	0.926	T-cell-specific surface glycoprotein CD28
14	9606.ENSP00000336829	0.913	Fibrinogen gamma chain
15	9606.ENSP00000379350	0.912	Integrin beta-1
16	9606.ENSP00000306361	0.909	Fibrinogen alpha chain
17	9606.ENSP00000306099	0.908	Fibrinogen beta chain
18	9606.ENSP00000386559	0.902	T-cell surface glycoprotein CD8 alpha chain
19	9606.ENSP00000361359	0.889	Tumor necrosis factor receptor superfamily member 5
20	9606.ENSP00000437940	0.885	B-lymphocyte antigen CD19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0038023	0.975	signaling receptor activity
GO:0005102	0.959	signaling receptor binding
GO:0050839	0.952	cell adhesion molecule binding
GO:0005178	0.870	integrin binding
GO:0019899	0.673	enzyme binding
GO:0019900	0.537	kinase binding
GO:0019901	0.528	protein kinase binding
GO:1990782	0.510	protein tyrosine kinase binding
GO:0030971	0.488	receptor tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0048518	0.964	positive regulation of biological process
GO:0048522	0.931	positive regulation of cellular process
GO:0007155	0.917	cell adhesion
GO:0050896	0.890	response to stimulus
GO:0019222	0.795	regulation of metabolic process
GO:0098609	0.777	cell-cell adhesion
GO:0051239	0.727	regulation of multicellular organismal process
GO:0051240	0.704	positive regulation of multicellular organismal process
GO:0009893	0.690	positive regulation of metabolic process
GO:0051716	0.630	cellular response to stimulus
GO:0032502	0.620	developmental process
GO:0060255	0.603	regulation of macromolecule metabolic process
GO:0048856	0.596	anatomical structure development
GO:0002376	0.528	immune system process
GO:0032501	0.502	multicellular organismal process
GO:0007154	0.475	cell communication
GO:0023052	0.471	signaling
GO:0010604	0.464	positive regulation of macromolecule metabolic process
GO:0007165	0.451	signal transduction
GO:0010468	0.440	regulation of gene expression
GO:0048583	0.430	regulation of response to stimulus
GO:0006950	0.404	response to stress
GO:0010628	0.393	positive regulation of gene expression
GO:0042127	0.386	regulation of cell population proliferation
GO:0002682	0.349	regulation of immune system process
GO:0031323	0.312	regulation of cellular metabolic process
GO:0002684	0.312	positive regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005886	0.999	plasma membrane
GO:0009986	0.998	cell surface
GO:0012505	0.992	endomembrane system
GO:0098636	0.990	protein complex involved in cell adhesion
GO:0098802	0.986	plasma membrane signaling receptor complex
GO:0005737	0.985	cytoplasm
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0008305	0.964	integrin complex
GO:0031982	0.928	vesicle
GO:0031410	0.861	cytoplasmic vesicle
GO:0031090	0.814	organelle membrane
GO:0005576	0.676	extracellular region
GO:0098588	0.661	bounding membrane of organelle
GO:0005615	0.621	extracellular space
GO:0070062	0.500	extracellular exosome
GO:0030667	0.450	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]