StarFunc result for job id P20719

User Input

>input (270 residues)
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG
SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKN
SLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09021	0.788	0.788	3.358E-35	270	0.978	0.978	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
2	AFDB:P09067	0.430	0.431	2.196E-22	269	0.630	0.632	P09067.pdb.gz	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
3	AFDB:P09013	0.369	0.362	2.214E-21	276	0.593	0.580	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
4	AFDB:P06798	0.285	0.271	1.159E-11	285	0.352	0.333	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
5	AFDB:P83949	0.218	0.155	9.119E-9	389	0.389	0.270	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
6	AFDB:P31269	0.272	0.270	1.355E-8	272	0.289	0.287	P31269.pdb.gz	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
7	AFDB:Q90262	0.281	0.256	7.059E-8	300	0.241	0.217	Q90262.pdb.gz
8	AFDB:P07548	0.261	0.126	3.222E-7	586	0.322	0.148	P07548.pdb.gz	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
9	AFDB:Q9DE09	0.243	0.200	4.788E-7	333	0.222	0.180	Q9DE09.pdb.gz	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
10	AFDB:P82976	0.231	0.151	1.129E-6	418	0.270	0.175	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
11	PDB:4egcA	0.176	0.089	1.335E-2	539	0.052	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.191	0.621	5.704E-2	73	0.059	0.219	2hi3A.pdb.gz
13	PDB:5nr5A	0.146	0.319	7.009E-1	113	0.037	0.088	5nr5A.pdb.gz
14	PDB:7fbyA	0.139	0.228	1.041	153	0.026	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:4ldzA	0.181	0.242	1.766	196	0.030	0.041	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:1yioA	0.124	0.163	2.153	198	0.033	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:5aj0BZ	0.152	0.408	2.300	86	0.033	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:6v7wE	0.134	0.153	3.418	234	0.044	0.051	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
19	PDB:2cg4A	0.148	0.256	3.651	149	0.022	0.040	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:4v88Ah	0.105	0.167	3.651	159	0.067	0.113	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09021	0.0	542	270	0.978	0.978	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
2	P20719	0.0	555	270	1.000	1.000	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
3	P52949	8.43e-152	424	233	0.807	0.936	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
4	P09013	2.83e-102	301	276	0.593	0.580	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
5	P09014	3.09e-102	301	275	0.619	0.607	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
6	P09067	9.36e-102	299	269	0.626	0.628	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
7	P09079	1.24e-101	299	269	0.626	0.628	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
8	P32043	2.20e-56	182	222	0.437	0.532	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
9	Q00444	1.84e-55	179	222	0.441	0.536	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1
10	Q08624	4.05e-44	152	264	0.267	0.273	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
11	P09017	4.76e-44	152	264	0.267	0.273	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2
12	P06798	6.05e-44	152	285	0.256	0.242	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
13	H0YHX3	7.80e-44	147	140	0.248	0.479	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
14	P09077	8.17e-44	155	417	0.278	0.180	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
15	Q86TF7	1.13e-43	150	264	0.267	0.273	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
16	P10284	2.40e-43	149	250	0.248	0.268	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
17	P17483	2.44e-43	149	251	0.263	0.283	HXB4_HUMAN Homeobox protein Hox-B4 OS=Homo sapiens OX=9606 GN=HOXB4 PE=1 SV=2
18	Q00056	4.76e-43	150	320	0.248	0.209	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
19	P17509	2.97e-42	146	224	0.233	0.281	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
20	P09023	3.03e-42	146	224	0.233	0.281	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09974 DUF2209	2.8e+02	13.2	Uncharacterized protein conserved in archaea (DUF2209)
2	PF05339 DUF739	7e+02	11.8	Protein of unknown function (DUF739)
3	PF05920 Homeobox_KN	4e+02	12.3	Homeobox KN domain
4	PF00046 Homeodomain	1.4e-18	77.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.945	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000364190	0.933	Pre-B-cell leukemia transcription factor 2
3	9606.ENSP00000362588	0.929	Pre-B-cell leukemia transcription factor 3
4	9606.ENSP00000239151	0.885	Homeobox protein Hox-B5
5	9606.ENSP00000222728	0.883	Homeobox protein Hox-A6
6	9606.ENSP00000242159	0.882	Homeobox protein Hox-A7
7	9606.ENSP00000399808	0.870	Homeobox protein Hox-C4
8	9606.ENSP00000328928	0.868	Homeobox protein Hox-B4
9	9606.ENSP00000272369	0.865	Homeobox protein Meis1
10	9606.ENSP00000239165	0.859	Homeobox protein Hox-B7
11	9606.ENSP00000420009	0.855	Homeobox protein Hox-B6
12	9606.ENSP00000243108	0.837	Homeobox protein Hox-C6
13	9606.ENSP00000309336	0.837	Homeobox protein Hox-C5
14	9606.ENSP00000302548	0.830	Homeobox protein Hox-D4
15	9606.ENSP00000222718	0.812	Homeobox protein Hox-A2
16	9606.ENSP00000476742	0.809	Uncharacterized protein
17	9606.ENSP00000331741	0.778	Homeobox protein Hox-B2
18	9606.ENSP00000353151	0.766	Homeobox protein Hox-A4
19	9606.ENSP00000207157	0.733	T-box transcription factor TBX15
20	9606.ENSP00000400341	0.725	Hepatocyte nuclear factor 3-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0140110	0.975	transcription regulator activity
GO:0003700	0.971	DNA-binding transcription factor activity
GO:0000981	0.960	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.945	transcription cis-regulatory region binding
GO:0000977	0.937	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.876	DNA-binding transcription activator activity
GO:0001228	0.862	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.858	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.635	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0010468	0.986	regulation of gene expression
GO:0032502	0.983	developmental process
GO:0048518	0.980	positive regulation of biological process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048856	0.972	anatomical structure development
GO:0032501	0.899	multicellular organismal process
GO:0007275	0.886	multicellular organism development
GO:0006357	0.881	regulation of transcription by RNA polymerase II
GO:0048731	0.801	system development
GO:0009893	0.801	positive regulation of metabolic process
GO:0048522	0.787	positive regulation of cellular process
GO:0010604	0.782	positive regulation of macromolecule metabolic process
GO:0009987	0.772	cellular process
GO:0051173	0.758	positive regulation of nitrogen compound metabolic process
GO:0045893	0.753	positive regulation of DNA-templated transcription
GO:0048513	0.705	animal organ development
GO:0045944	0.671	positive regulation of transcription by RNA polymerase II
GO:0048519	0.571	negative regulation of biological process
GO:0009653	0.546	anatomical structure morphogenesis
GO:0048523	0.456	negative regulation of cellular process
GO:0009892	0.300	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.446	nuclear lumen
GO:0005737	0.436	cytoplasm
GO:0005654	0.428	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]