StarFunc result for job id P20742

User Input

>input (1482 residues)
MRKDRLLHLCLVLLLILLSASDSNSTEPQYMVLVPSLLHTEAPKKGCVLLSHLNETVTVS
ASLESGRENRSLFTDLVAEKDLFHCVSFTLPRISASSEVAFLSIQIKGPTQDFRKRNTVL
VLNTQSLVFVQTDKPMYKPGQTVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSL
KLEAGINQLSFPLSSEPIQGSYRVVVQTESGGRIQHPFTVEEFVLPKFEVKVQVPKIISI
MDEKVNITVCGEYTYGKPVPGLATVSLCRKLSRVLNCDKQEVCEEFSQQLNSNGCITQQV
HTKMLQITNTGFEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVKVDSHFRQGIP
FFAQVLLVDGKGVPIPNKLFFISVNDANYYSNATTNEQGLAQFSINTTSISVNKLFVRVF
TVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYTLNR
QAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFA
ILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSV
LLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEA
DIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYN
VIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSE
DAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLKASPAF
LASQNTKGEESYCICGNERQTLSWTVTPKTLGNVNFSVSAEAMQSLELCGNEVVEVPEIK
RKDTVIKTLLVEAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDI
LGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQR
QLNYKHQDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARSYIFIDEAHITQSLTWLSQMQ
KDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIALLEIPLPVTNPIVRNALFCLESAWNV
AKEGTHGSHVYTKALLAYAFSLLGKQNQNREILNSLDKEAVKEDNLVHWERPQRPKAPVG
HLYQTQAPSAEVEMTSYVLLAYLTAQPAPTSGDLTSATNIVKWIMKQQNAQGGFSSTQDT
VVALHALSRYGAATFTRTEKTAQVTVQDSQTFSTNFQVDNNNLLLLQQISLPELPGEYVI
TVTGERCVYLQTSMKYNILPEKEDSPFALKVQTVPQTCDGHKAHTSFQISLTISYTGNRP
ASNMVIVDVKMVSGFIPLKPTVKMLERSSSVSRTEVSNNHVLIYVEQVTNQTLSFSFMVL
QDIPVGDLKPAIVKVYDYYETDESVVAEYIAPCSTDTEHGNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q1yA	0.860	0.925	0.000	1374	0.368	0.397	7q1yA.pdb.gz
2	PDB:7q5zA	0.836	0.917	0.000	1344	0.364	0.402	7q5zA.pdb.gz
3	PDB:7vonA	0.891	0.943	0.000	1399	0.692	0.733	7vonA.pdb.gz
4	AFDB:A0A0R4IDD1	0.844	0.866	0.000	1442	0.364	0.374	A0A0R4IDD1.pdb.gz
5	AFDB:A8K2U0	0.898	0.915	0.000	1454	0.381	0.389	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
6	AFDB:M9PDR0	0.783	0.775	0.000	1498	0.242	0.239	M9PDR0.pdb.gz	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
7	AFDB:P01023	0.960	0.965	0.000	1474	0.716	0.720	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
8	AFDB:P20742	1.000	1.000	0.000	1482	1.000	1.000	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
9	AFDB:P28665	0.928	0.931	0.000	1476	0.572	0.575	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
10	AFDB:Q03626	0.930	0.927	0.000	1487	0.580	0.578	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
11	AFDB:Q61838	0.965	0.957	0.000	1495	0.552	0.547	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
12	AFDB:Q63041	0.960	0.949	0.000	1500	0.554	0.547	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
13	AFDB:Q6GQT1	0.948	0.953	0.000	1474	0.634	0.638	Q6GQT1.pdb.gz	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
14	PDB:4lnvA	0.599	0.685	6.754E-87	1276	0.211	0.245	4lnvA.pdb.gz
15	PDB:7nycA	0.408	0.395	3.422E-75	1542	0.215	0.206	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4lnvB	0.547	0.741	7.159E-65	1063	0.188	0.262	4lnvB.pdb.gz
17	PDB:6h03A	0.416	0.494	1.579E-63	1223	0.198	0.240	6h03A.pdb.gz
18	PDB:5a42A	0.484	0.453	7.158E-57	1597	0.135	0.125	5a42A.pdb.gz
19	PDB:4ziqA	0.326	0.332	1.234E-53	1450	0.138	0.141	4ziqA.pdb.gz
20	PDB:4rtdA	0.320	0.397	4.174E-45	1122	0.126	0.166	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K2U0	0.0	1003	1454	0.378	0.385	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
2	B8QSI4	0.0	953	1442	0.383	0.393	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1
3	P01023	0.0	2158	1474	0.717	0.720	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
4	P06238	0.0	1931	1472	0.641	0.645	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
5	P20742	0.0	3071	1482	1.000	1.000	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
6	P28665	0.0	1715	1476	0.578	0.580	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
7	Q03626	0.0	1715	1487	0.582	0.580	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
8	Q61838	0.0	1608	1495	0.562	0.557	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
9	Q63041	0.0	1628	1500	0.559	0.553	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
10	Q6GQT1	0.0	1905	1474	0.634	0.637	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
11	Q7SIH1	0.0	2050	1510	0.684	0.672	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
12	Q6YHK3	1.79e-149	495	1445	0.290	0.298	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
13	Q8R422	1.93e-114	397	1442	0.200	0.205	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
14	Q9NFV8	9.99e-104	364	1354	0.257	0.281	Q9NFV8_DROME TEP1 protein OS=Drosophila melanogaster OX=7227 GN=Tep1 PE=2 SV=1
15	Q9NFV6	1.68e-101	359	1469	0.238	0.240	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
16	Q9VLY7	3.58e-101	358	1469	0.238	0.240	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
17	Q9NFV7	1.44e-98	350	1420	0.165	0.173	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
18	M9PDR0	3.11e-86	313	1498	0.180	0.178	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
19	M9PDF6	3.94e-86	312	1478	0.181	0.181	M9PDF6_DROME Thioester-containing protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
20	Q8IZJ3	1.13e-82	303	1885	0.131	0.103	CPMD8_HUMAN C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	4e-28	108.4	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	4.5e-29	113.0	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	1.8e-22	91.1	A-macroglobulin receptor binding domain
4	PF02369 Big_1	18	16.8	Bacterial Ig-like domain (group 1)
5	PF14792 DNA_pol_B_palm	2.6e+02	13.2	DNA polymerase beta palm
6	PF01835 MG2	3.8e-15	67.4	MG2 domain
7	PF17791 MG3	2.9e-23	93.3	Macroglobulin domain MG3
8	PF17789 MG4	9.9e-21	85.1	Macroglobulin domain MG4
9	PF13249 SQHop_cyclase_N	3.6e+02	11.7	Squalene-hopene cyclase N-terminal domain
10	PF05326 SVA	0.0076	27.6	Seminal vesicle autoantigen (SVA)
11	PF07678 TED_complement	4e-117	402.3	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419786	0.649	Retrotransposon Gag-like protein 9
2	9606.ENSP00000477515	0.637	Diacylglycerol kinase kappa
3	9606.ENSP00000301825	0.611	Ectonucleoside triphosphate diphosphohydrolase 3
4	9606.ENSP00000348170	0.581	Haptoglobin
5	9606.ENSP00000355896	0.577	Transforming growth factor beta-2
6	9606.ENSP00000324173	0.569	78 kDa glucose-regulated protein
7	9606.ENSP00000308541	0.568	Prothrombin
8	9606.ENSP00000394936	0.568	Alpha-1-acid glycoprotein 2
9	9606.ENSP00000360250	0.567	Ectonucleoside triphosphate diphosphohydrolase 1
10	9606.ENSP00000286760	0.547	WASP homolog-associated protein with actin, membranes and microtubules
11	9606.ENSP00000221930	0.544	Transforming growth factor beta-1
12	9606.ENSP00000373340	0.543	Peregrin
13	9606.ENSP00000482304	0.517	Zona pellucida sperm-binding protein 4
14	9606.ENSP00000321853	0.515	Alpha-2-antiplasmin
15	9606.ENSP00000369816	0.513	Sex hormone-binding globulin
16	9606.ENSP00000216267	0.505	Bromodomain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030414	0.999	peptidase inhibitor activity
GO:0061135	0.980	endopeptidase regulator activity
GO:0004866	0.971	endopeptidase inhibitor activity
GO:0019899	0.368	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.966	multicellular organismal process
GO:0050789	0.876	regulation of biological process
GO:0050896	0.656	response to stimulus
GO:0009987	0.623	cellular process
GO:0044703	0.504	multi-organism reproductive process
GO:0044706	0.491	multi-multicellular organism process
GO:0032502	0.459	developmental process
GO:0006950	0.404	response to stress
GO:0048583	0.381	regulation of response to stimulus
GO:0048519	0.379	negative regulation of biological process
GO:0007565	0.356	female pregnancy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.995	cell periphery
GO:0043227	0.995	membrane-bounded organelle
GO:0005615	0.995	extracellular space
GO:0070062	0.993	extracellular exosome
GO:0031012	0.986	extracellular matrix
GO:0070013	0.914	intracellular organelle lumen
GO:0062023	0.909	collagen-containing extracellular matrix
GO:0012505	0.893	endomembrane system
GO:0072562	0.795	blood microparticle
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0005737	0.637	cytoplasm
GO:0030141	0.486	secretory granule
GO:0016020	0.372	membrane
GO:0034774	0.362	secretory granule lumen
GO:0031091	0.333	platelet alpha granule
GO:0031093	0.312	platelet alpha granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]