StarFunc result for job id P20749

User Input

>input (454 residues)
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20749	0.999	0.999	4.454E-54	454	1.000	1.000	P20749.pdb.gz	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
2	AFDB:Q9Z2F6	0.646	0.653	2.271E-43	448	0.815	0.826	Q9Z2F6.pdb.gz	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
3	AFDB:Q04861	0.499	0.235	2.677E-14	983	0.214	0.099	Q04861.pdb.gz	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
4	AFDB:G5EFS1	0.495	0.379	1.405E-13	597	0.170	0.129	G5EFS1.pdb.gz	G5EFS1_CAEEL Death domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ikb-1 PE=1 SV=1
5	AFDB:A0A0R4IYN3	0.266	0.107	3.220E-13	1274	0.216	0.077	A0A0R4IYN3.pdb.gz	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
6	AFDB:A0A2R8RJY5	0.436	0.233	3.220E-13	863	0.203	0.107	A0A2R8RJY5.pdb.gz
7	AFDB:Q60778	0.453	0.569	3.835E-13	359	0.258	0.326	Q60778.pdb.gz	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
8	PDB:8cs9A	0.448	0.263	1.447E-12	796	0.161	0.092	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	AFDB:Q69ZU8	0.450	0.292	1.766E-12	712	0.189	0.121	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
10	AFDB:F1RBU2	0.463	0.292	2.854E-12	729	0.192	0.119	F1RBU2.pdb.gz
11	AFDB:P25963	0.452	0.639	3.550E-12	317	0.189	0.271	P25963.pdb.gz	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
12	PDB:2dvwA	0.438	0.833	5.712E-10	229	0.126	0.249	2dvwA.pdb.gz
13	PDB:1wg0A	0.412	0.721	2.025E-9	243	0.130	0.243	1wg0A.pdb.gz
14	PDB:4oauC	0.338	0.240	2.871E-9	692	0.154	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6aunA	0.385	0.292	8.546E-9	618	0.139	0.102	6aunA.pdb.gz
16	PDB:5vkqA	0.363	0.129	1.718E-8	1499	0.148	0.045	5vkqA.pdb.gz
17	PDB:6v9hC	0.426	0.685	1.718E-8	270	0.137	0.230	6v9hC.pdb.gz
18	PDB:6pqpA	0.341	0.258	9.518E-7	615	0.108	0.080	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.308	0.684	2.088E-6	192	0.115	0.271	6jd6B.pdb.gz
20	PDB:6mwqA	0.276	0.255	4.196E-6	493	0.112	0.103	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C0A2	0.0	557	308	0.632	0.932	H7C0A2_HUMAN BCL3 transcription coactivator (Fragment) OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=1
2	P20749	0.0	889	454	1.000	1.000	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
3	Q9Z2F6	0.0	671	448	0.813	0.824	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
4	E7FFI8	6.67e-92	292	619	0.341	0.250	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
5	A0A8I6ASQ1	8.87e-49	172	358	0.233	0.296	A0A8I6ASQ1_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=1 SV=1
6	Q6P780	1.71e-45	164	365	0.222	0.277	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
7	O54910	2.29e-44	160	364	0.220	0.275	IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus OX=10090 GN=Nfkbie PE=1 SV=2
8	Q7LC14	2.72e-44	160	361	0.220	0.277	Q7LC14_HUMAN NFKB inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=1
9	O00221	3.53e-44	163	500	0.220	0.200	IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=3
10	Q00653	6.25e-36	143	900	0.196	0.099	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
11	A0A8I6G6F3	4.40e-33	135	902	0.183	0.092	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
12	Q20KN0	9.20e-33	130	439	0.189	0.196	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
13	Q9WTK5	5.27e-32	131	899	0.181	0.091	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
14	Q04861	1.29e-29	124	983	0.229	0.106	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
15	Q60778	1.55e-29	120	359	0.205	0.259	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
16	Q9JIA3	4.44e-29	119	359	0.205	0.259	IKBB_RAT NF-kappa-B inhibitor beta OS=Rattus norvegicus OX=10116 GN=Nfkbib PE=1 SV=1
17	Q15653	7.65e-29	118	356	0.205	0.261	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2
18	P19838	1.35e-28	121	968	0.209	0.098	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
19	Q03017	2.42e-28	119	500	0.167	0.152	CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster OX=7227 GN=cact PE=1 SV=2
20	Q63369	6.81e-28	118	522	0.211	0.184	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.8e-27	103.8	Ankyrin repeat
2	PF12796 Ank_2	2.8e-31	119.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.8e-25	95.1	Ankyrin repeat
4	PF13637 Ank_4	1.3e-24	97.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.8e-23	93.6	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000164227

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358983	0.991	Nuclear factor NF-kappa-B p100 subunit
2	9606.ENSP00000226574	0.990	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000384273	0.963	Transcription factor p65
4	9606.ENSP00000392025	0.963	Ubiquitin carboxyl-terminal hydrolase CYLD
5	9606.ENSP00000221452	0.944	Transcription factor RelB
6	9606.ENSP00000362649	0.835	Histone deacetylase 1
7	9606.ENSP00000346671	0.822	Tyrosine-protein kinase Fyn
8	9606.ENSP00000295025	0.819	Proto-oncogene c-Rel
9	9606.ENSP00000369786	0.818	Pirin
10	9606.ENSP00000216797	0.816	NF-kappa-B inhibitor alpha
11	9606.ENSP00000252483	0.721	Nectin-2
12	9606.ENSP00000302967	0.635	Histone deacetylase 3
13	9606.ENSP00000350512	0.630	COP9 signalosome complex subunit 5
14	9606.ENSP00000354733	0.627	Protein strawberry notch homolog 2
15	9606.ENSP00000466775	0.607	Apolipoprotein C-II
16	9606.ENSP00000284000	0.605	CCAAT/enhancer-binding protein gamma
17	9606.ENSP00000290921	0.605	C-terminal-binding protein 1
18	9606.ENSP00000371194	0.605	Lymphocyte-specific protein 1
19	9606.ENSP00000264657	0.603	Signal transducer and activator of transcription 3
20	9606.ENSP00000340330	0.590	Histone acetyltransferase KAT5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003712	1.000	transcription coregulator activity
GO:0019899	0.986	enzyme binding
GO:0008134	0.965	transcription factor binding
GO:0140297	0.912	DNA-binding transcription factor binding
GO:0042826	0.829	histone deacetylase binding
GO:0003714	0.717	transcription corepressor activity
GO:0060090	0.701	molecular adaptor activity
GO:0030674	0.685	protein-macromolecule adaptor activity
GO:0097159	0.337	organic cyclic compound binding
GO:1901363	0.336	heterocyclic compound binding
GO:0003824	0.306	catalytic activity
GO:0003676	0.304	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.989	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048518	0.980	positive regulation of biological process
GO:0010468	0.976	regulation of gene expression
GO:0009893	0.966	positive regulation of metabolic process
GO:2001141	0.966	regulation of RNA biosynthetic process
GO:0051716	0.952	cellular response to stimulus
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048583	0.923	regulation of response to stimulus
GO:0048523	0.914	negative regulation of cellular process
GO:0048522	0.894	positive regulation of cellular process
GO:0009892	0.880	negative regulation of metabolic process
GO:0010557	0.873	positive regulation of macromolecule biosynthetic process
GO:0045935	0.862	positive regulation of nucleobase-containing compound metabolic process
GO:0023052	0.853	signaling
GO:0045893	0.826	positive regulation of DNA-templated transcription
GO:0009966	0.770	regulation of signal transduction
GO:0010605	0.741	negative regulation of macromolecule metabolic process
GO:0065009	0.697	regulation of molecular function
GO:0010941	0.667	regulation of cell death
GO:0006950	0.663	response to stress
GO:0007154	0.658	cell communication
GO:0051239	0.654	regulation of multicellular organismal process
GO:0043067	0.654	regulation of programmed cell death
GO:0008152	0.653	metabolic process
GO:0001817	0.644	regulation of cytokine production
GO:0007165	0.632	signal transduction
GO:0071704	0.624	organic substance metabolic process
GO:0042981	0.622	regulation of apoptotic process
GO:0051090	0.564	regulation of DNA-binding transcription factor activity
GO:0044238	0.540	primary metabolic process
GO:0006357	0.533	regulation of transcription by RNA polymerase II
GO:0051172	0.521	negative regulation of nitrogen compound metabolic process
GO:0009605	0.519	response to external stimulus
GO:0031324	0.519	negative regulation of cellular metabolic process
GO:0043170	0.500	macromolecule metabolic process
GO:0006807	0.498	nitrogen compound metabolic process
GO:1902531	0.498	regulation of intracellular signal transduction
GO:0044092	0.483	negative regulation of molecular function
GO:0051246	0.467	regulation of protein metabolic process
GO:0008219	0.465	cell death
GO:0032501	0.457	multicellular organismal process
GO:0009607	0.455	response to biotic stimulus
GO:0044419	0.448	biological process involved in interspecies interaction between organisms
GO:0043066	0.446	negative regulation of apoptotic process
GO:0048584	0.428	positive regulation of response to stimulus
GO:0010629	0.425	negative regulation of gene expression
GO:0042221	0.415	response to chemical
GO:0044237	0.411	cellular metabolic process
GO:0048585	0.410	negative regulation of response to stimulus
GO:0010558	0.407	negative regulation of macromolecule biosynthetic process
GO:0002376	0.404	immune system process
GO:0051247	0.400	positive regulation of protein metabolic process
GO:0006915	0.394	apoptotic process
GO:0045944	0.393	positive regulation of transcription by RNA polymerase II
GO:0023057	0.378	negative regulation of signaling
GO:0010648	0.378	negative regulation of cell communication
GO:0032502	0.373	developmental process
GO:0031327	0.372	negative regulation of cellular biosynthetic process
GO:0051707	0.364	response to other organism
GO:0009968	0.359	negative regulation of signal transduction
GO:0035556	0.356	intracellular signal transduction
GO:0045892	0.355	negative regulation of DNA-templated transcription
GO:0048856	0.351	anatomical structure development
GO:0071840	0.345	cellular component organization or biogenesis
GO:0010033	0.334	response to organic substance
GO:0080134	0.329	regulation of response to stress
GO:0070887	0.318	cellular response to chemical stimulus
GO:0033554	0.310	cellular response to stress
GO:0016043	0.308	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.997	cytosol
GO:0016020	0.986	membrane
GO:0071944	0.985	cell periphery
GO:0005886	0.981	plasma membrane
GO:0032991	0.979	protein-containing complex
GO:0140535	0.469	intracellular protein-containing complex
GO:0033257	0.390	Bcl3/NF-kappaB2 complex
GO:0030496	0.388	midbody
GO:0032996	0.385	Bcl3-Bcl10 complex
GO:0043232	0.345	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]