StarFunc result for job id P20774

User Input

>input (298 residues)
MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEK
ETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLL
KLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIH
LQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DI63	0.713	0.598	3.357E-46	356	0.993	0.831	B4DI63.pdb.gz	B4DI63_HUMAN cDNA FLJ59205, highly similar to Mimecan OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:D3ZVB7	0.730	0.730	4.428E-42	298	0.856	0.856	D3ZVB7.pdb.gz	D3ZVB7_RAT Osteoglycin OS=Rattus norvegicus OX=10116 GN=Ogn PE=1 SV=1
3	AFDB:A8BBE6	0.691	0.643	8.834E-26	321	0.413	0.383	A8BBE6.pdb.gz
4	AFDB:P70186	0.694	0.644	2.506E-25	322	0.416	0.385	P70186.pdb.gz	EPYC_MOUSE Epiphycan OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1
5	AFDB:Q99645	0.702	0.650	7.488E-25	322	0.433	0.401	Q99645.pdb.gz	EPYC_HUMAN Epiphycan OS=Homo sapiens OX=9606 GN=EPYC PE=2 SV=3
6	AFDB:Q9UBM4	0.705	0.635	8.311E-25	332	0.376	0.337	Q9UBM4.pdb.gz	OPT_HUMAN Opticin OS=Homo sapiens OX=9606 GN=OPTC PE=1 SV=1
7	AFDB:Q920A0	0.723	0.659	2.904E-24	328	0.376	0.341	Q920A0.pdb.gz	OPT_MOUSE Opticin OS=Mus musculus OX=10090 GN=Optc PE=1 SV=2
8	AFDB:A8BBB9	0.686	0.655	6.687E-24	312	0.403	0.385	A8BBB9.pdb.gz
9	AFDB:Q01129	0.502	0.431	8.284E-13	354	0.221	0.186	Q01129.pdb.gz	PGS2_RAT Decorin OS=Rattus norvegicus OX=10116 GN=Dcn PE=1 SV=1
10	AFDB:P21793	0.454	0.381	3.957E-12	360	0.262	0.217	P21793.pdb.gz	PGS2_BOVIN Decorin OS=Bos taurus OX=9913 GN=DCN PE=1 SV=2
11	PDB:1xcdA	0.510	0.500	2.448E-10	305	0.195	0.190	1xcdA.pdb.gz
12	PDB:5yq5B	0.497	0.486	5.637E-10	306	0.191	0.186	5yq5B.pdb.gz
13	PDB:2ft3F	0.484	0.475	1.368E-9	305	0.181	0.177	2ft3F.pdb.gz
14	PDB:7tvfD	0.402	0.246	1.081E-6	515	0.174	0.101	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:3b2dA	0.449	0.236	1.331E-6	601	0.161	0.080	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:6hkwA	0.407	0.398	3.402E-6	306	0.151	0.147	6hkwA.pdb.gz
17	PDB:5xjxC	0.396	0.330	1.189E-5	365	0.097	0.079	5xjxC.pdb.gz
18	PDB:7lt9A	0.403	0.469	1.900E-5	251	0.154	0.183	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
19	PDB:6gffI	0.375	0.216	2.222E-5	551	0.138	0.074	6gffI.pdb.gz
20	PDB:7p5vB	0.388	0.171	3.038E-5	732	0.131	0.053	7p5vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DI63	0.0	598	356	0.993	0.831	B4DI63_HUMAN cDNA FLJ59205, highly similar to Mimecan OS=Homo sapiens OX=9606 PE=2 SV=1
2	D3ZVB7	0.0	506	298	0.856	0.856	D3ZVB7_RAT Osteoglycin OS=Rattus norvegicus OX=10116 GN=Ogn PE=1 SV=1
3	P20774	0.0	598	298	1.000	1.000	MIME_HUMAN Mimecan OS=Homo sapiens OX=9606 GN=OGN PE=1 SV=1
4	Q62000	0.0	517	298	0.852	0.852	MIME_MOUSE Mimecan OS=Mus musculus OX=10090 GN=Ogn PE=1 SV=1
5	Q99645	4.88e-72	226	322	0.349	0.323	EPYC_HUMAN Epiphycan OS=Homo sapiens OX=9606 GN=EPYC PE=2 SV=3
6	P70186	1.97e-71	225	322	0.339	0.314	EPYC_MOUSE Epiphycan OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1
7	Q9UBM4	1.94e-66	213	332	0.326	0.292	OPT_HUMAN Opticin OS=Homo sapiens OX=9606 GN=OPTC PE=1 SV=1
8	Q920A0	6.06e-64	206	328	0.322	0.293	OPT_MOUSE Opticin OS=Mus musculus OX=10090 GN=Optc PE=1 SV=2
9	P51884	7.94e-17	81.6	338	0.211	0.186	LUM_HUMAN Lumican OS=Homo sapiens OX=9606 GN=LUM PE=1 SV=2
10	O35103	1.09e-15	79.0	423	0.191	0.135	OMD_MOUSE Osteomodulin OS=Mus musculus OX=10090 GN=Omd PE=2 SV=1
11	O75094	2.43e-15	78.6	1523	0.191	0.037	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
12	P51885	3.54e-15	77.0	338	0.205	0.180	LUM_MOUSE Lumican OS=Mus musculus OX=10090 GN=Lum PE=1 SV=2
13	Q9WVB4	3.82e-15	78.2	1523	0.191	0.037	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
14	P51886	4.13e-15	76.6	338	0.205	0.180	LUM_RAT Lumican OS=Rattus norvegicus OX=10116 GN=Lum PE=1 SV=1
15	Q9XSD9	4.86e-15	76.6	360	0.191	0.158	PGS2_PIG Decorin OS=Sus scrofa OX=9823 GN=DCN PE=2 SV=1
16	P07585	1.48e-14	75.1	359	0.188	0.156	PGS2_HUMAN Decorin OS=Homo sapiens OX=9606 GN=DCN PE=1 SV=1
17	O88280	1.56e-14	76.3	1523	0.188	0.037	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
18	F1SQ09	1.66e-14	75.1	341	0.195	0.170	F1SQ09_PIG Lumican OS=Sus scrofa OX=9823 GN=LUM PE=1 SV=1
19	P21793	1.69e-14	75.1	360	0.188	0.156	PGS2_BOVIN Decorin OS=Bos taurus OX=9913 GN=DCN PE=1 SV=2
20	Q99983	1.98e-14	75.1	421	0.191	0.135	OMD_HUMAN Osteomodulin OS=Homo sapiens OX=9606 GN=OMD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	0.029	25.6	Leucine Rich Repeat
2	PF12799 LRR_4	6.9e-07	40.7	Leucine Rich repeats (2 copies)
3	PF13306 LRR_5	7.5	18.0	BspA type Leucine rich repeat region (6 copies)
4	PF13516 LRR_6	22	16.5	Leucine Rich repeat
5	PF13855 LRR_8	8.3e-16	68.8	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364700	0.964	Osteomodulin
2	9606.ENSP00000266718	0.943	Lumican
3	9606.ENSP00000387356	0.940	Aggrecan core protein
4	9606.ENSP00000343924	0.937	Prolargin
5	9606.ENSP00000347041	0.937	Fibromodulin
6	9606.ENSP00000266719	0.935	Keratocan
7	9606.ENSP00000328983	0.912	Carbohydrate sulfotransferase 6
8	9606.ENSP00000338783	0.912	Carbohydrate sulfotransferase 5
9	9606.ENSP00000305595	0.909	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
10	9606.ENSP00000287590	0.907	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
11	9606.ENSP00000310696	0.906	Beta-1,4-galactosyltransferase 2
12	9606.ENSP00000436047	0.906	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
13	9606.ENSP00000480428	0.906	Beta-1,4-galactosyltransferase 3
14	9606.ENSP00000480884	0.906	Type 2 lactosamine alpha-2,3-sialyltransferase
15	9606.ENSP00000420161	0.904	Beta-1,4-galactosyltransferase 4
16	9606.ENSP00000309270	0.902	Carbohydrate sulfotransferase 1
17	9606.ENSP00000319636	0.902	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
18	9606.ENSP00000321874	0.902	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
19	9606.ENSP00000377257	0.902	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
20	9606.ENSP00000428540	0.902	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.961	regulation of cellular process
GO:0048523	0.790	negative regulation of cellular process
GO:0009987	0.702	cellular process
GO:0042127	0.630	regulation of cell population proliferation
GO:0048660	0.528	regulation of smooth muscle cell proliferation
GO:0032501	0.500	multicellular organismal process
GO:0032502	0.474	developmental process
GO:0008285	0.467	negative regulation of cell population proliferation
GO:0048856	0.436	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.999	extracellular matrix
GO:0012505	0.998	endomembrane system
GO:0005576	0.998	extracellular region
GO:0070013	0.994	intracellular organelle lumen
GO:0005615	0.991	extracellular space
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0062023	0.986	collagen-containing extracellular matrix
GO:0005737	0.981	cytoplasm
GO:0005794	0.957	Golgi apparatus
GO:1903561	0.926	extracellular vesicle
GO:0070062	0.924	extracellular exosome
GO:0016020	0.352	membrane
GO:0005764	0.305	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]