StarFunc result for job id P20783

User Input

>input (257 residues)
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18280	0.699	0.697	5.323E-41	258	0.961	0.957	P18280.pdb.gz	NTF3_RAT Neurotrophin-3 OS=Rattus norvegicus OX=10116 GN=Ntf3 PE=2 SV=1
2	AFDB:Q568T2	0.546	0.482	8.531E-24	294	0.514	0.449	Q568T2.pdb.gz
3	AFDB:P25428	0.529	0.555	5.060E-22	244	0.377	0.398	P25428.pdb.gz	NGFV_MACLB Venom nerve growth factor OS=Macrovipera lebetina OX=8709 PE=1 SV=2
4	AFDB:P01138	0.532	0.566	6.310E-22	241	0.420	0.448	P01138.pdb.gz	NGF_HUMAN Beta-nerve growth factor OS=Homo sapiens OX=9606 GN=NGF PE=1 SV=3
5	AFDB:P24727	0.517	0.560	2.040E-20	236	0.389	0.424	P24727.pdb.gz	NTF4_XENLA Neurotrophin-4 OS=Xenopus laevis OX=8355 GN=ntf4 PE=2 SV=1
6	AFDB:P01139	0.425	0.451	2.156E-20	241	0.405	0.432	P01139.pdb.gz	NGF_MOUSE Beta-nerve growth factor OS=Mus musculus OX=10090 GN=Ngf PE=1 SV=2
7	AFDB:A0A0B5JS44	0.504	0.655	5.080E-18	194	0.335	0.443	A0A0B5JS44.pdb.gz
8	AFDB:P21237	0.507	0.521	9.321E-18	249	0.374	0.386	P21237.pdb.gz	BDNF_MOUSE Brain-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Bdnf PE=1 SV=1
9	AFDB:Q4JHT7	0.418	0.436	3.138E-17	246	0.393	0.411	Q4JHT7.pdb.gz	Q4JHT7_TAEGU Brain-derived neurotrophic factor OS=Taeniopygia guttata OX=59729 GN=BDNF PE=2 SV=1
10	AFDB:Q6NZ01	0.420	0.401	6.084E-17	270	0.389	0.370	Q6NZ01.pdb.gz	Q6NZ01_DANRE Brain-derived neurotrophic factor OS=Danio rerio OX=7955 GN=bdnf PE=2 SV=1
11	PDB:4efvB	0.403	0.930	7.462E-14	108	0.249	0.593	4efvB.pdb.gz
12	PDB:3ij2A	0.407	0.922	9.832E-14	110	0.253	0.591	3ij2A.pdb.gz
13	PDB:3am2A	0.161	0.148	3.951E-1	286	0.039	0.035	3am2A.pdb.gz
14	PDB:5ltwL	0.103	0.195	4.175E-1	100	0.058	0.150	5ltwL.pdb.gz
15	PDB:2k8pA	0.142	0.180	4.927E-1	189	0.109	0.148	2k8pA.pdb.gz
16	PDB:5hk5F	0.122	0.187	4.927E-1	129	0.054	0.109	5hk5F.pdb.gz
17	PDB:5iv5BG	0.093	0.108	6.144E-1	192	0.051	0.068	5iv5BG.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:1m4uA	0.277	0.342	8.095E-1	199	0.113	0.146	1m4uA.pdb.gz
19	PDB:7uwmA	0.167	0.340	9.040E-1	109	0.054	0.128	7uwmA.pdb.gz
20	PDB:4qhuC	0.205	0.392	1.330	119	0.070	0.151	4qhuC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18280	0.0	512	258	0.961	0.957	NTF3_RAT Neurotrophin-3 OS=Rattus norvegicus OX=10116 GN=Ntf3 PE=2 SV=1
2	P20181	0.0	512	258	0.961	0.957	NTF3_MOUSE Neurotrophin-3 OS=Mus musculus OX=10090 GN=Ntf3 PE=1 SV=1
3	P20783	0.0	536	257	1.000	1.000	NTF3_HUMAN Neurotrophin-3 OS=Homo sapiens OX=9606 GN=NTF3 PE=1 SV=1
4	P25427	6.86e-59	189	241	0.432	0.461	NGF_RAT Beta-nerve growth factor OS=Rattus norvegicus OX=10116 GN=Ngf PE=2 SV=2
5	P01138	1.79e-57	185	241	0.416	0.444	NGF_HUMAN Beta-nerve growth factor OS=Homo sapiens OX=9606 GN=NGF PE=1 SV=3
6	P01139	9.10e-57	183	241	0.420	0.448	NGF_MOUSE Beta-nerve growth factor OS=Mus musculus OX=10090 GN=Ngf PE=1 SV=2
7	P24727	2.72e-56	182	236	0.350	0.381	NTF4_XENLA Neurotrophin-4 OS=Xenopus laevis OX=8355 GN=ntf4 PE=2 SV=1
8	P25428	7.15e-56	181	244	0.405	0.426	NGFV_MACLB Venom nerve growth factor OS=Macrovipera lebetina OX=8709 PE=1 SV=2
9	P34131	6.65e-48	159	209	0.362	0.445	NTF4_RAT Neurotrophin-4 OS=Rattus norvegicus OX=10116 GN=Ntf4 PE=2 SV=1
10	P34130	4.35e-47	157	210	0.346	0.424	NTF4_HUMAN Neurotrophin-4 OS=Homo sapiens OX=9606 GN=NTF4 PE=1 SV=1
11	Q80VU4	6.16e-47	157	209	0.358	0.440	NTF4_MOUSE Neurotrophin-4 OS=Mus musculus OX=10090 GN=Ntf4 PE=2 SV=1
12	J9PBR9	2.64e-46	152	117	0.257	0.564	J9PBR9_LAMGL Ovulation-inducing factor (OIF) OS=Lama glama OX=9844 PE=1 SV=1
13	Q4JHT7	8.87e-45	152	246	0.416	0.435	Q4JHT7_TAEGU Brain-derived neurotrophic factor OS=Taeniopygia guttata OX=59729 GN=BDNF PE=2 SV=1
14	P23363	4.11e-44	151	249	0.377	0.390	BDNF_RAT Brain-derived neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Bdnf PE=2 SV=1
15	P21237	4.38e-44	151	249	0.377	0.390	BDNF_MOUSE Brain-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Bdnf PE=1 SV=1
16	A0A0E3SU01	2.27e-43	149	247	0.370	0.385	A0A0E3SU01_HUMAN Brain-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=BDNF PE=2 SV=1
17	P23560	2.27e-43	149	247	0.370	0.385	BDNF_HUMAN Brain-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=BDNF PE=1 SV=1
18	K4MQC6	2.71e-43	149	246	0.331	0.346	K4MQC6_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=1
19	K4MNE5	3.15e-43	149	246	0.331	0.346	K4MNE5_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=1
20	P25429	3.15e-43	149	246	0.331	0.346	BDNF_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00243 NGF	1.3e-48	175.2	Nerve growth factor family
2	PF19338 NTF3_N	3.9e-51	183.5	Neutrophin-3 N-terminus
3	PF16077 Spaetzle	3.4	19.6	Spaetzle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397297

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277120	0.999	BDNF/NT-3 growth factors receptor
2	9606.ENSP00000354207	0.999	NT-3 growth factor receptor
3	9606.ENSP00000431418	0.999	High affinity nerve growth factor receptor
4	9606.ENSP00000172229	0.998	Tumor necrosis factor receptor superfamily member 16
5	9606.ENSP00000414303	0.993	Brain-derived neurotrophic factor
6	9606.ENSP00000340944	0.942	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000401303	0.936	SHC-transforming protein 1
8	9606.ENSP00000244007	0.929	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
9	9606.ENSP00000349932	0.925	Receptor-type tyrosine-protein phosphatase S
10	9606.ENSP00000264657	0.919	Signal transducer and activator of transcription 3
11	9606.ENSP00000407586	0.919	GTPase HRas
12	9606.ENSP00000256078	0.917	GTPase KRas
13	9606.ENSP00000358525	0.916	Beta-nerve growth factor
14	9606.ENSP00000440374	0.916	Guanine nucleotide exchange factor DBS
15	9606.ENSP00000447241	0.915	Fibroblast growth factor receptor substrate 2
16	9606.ENSP00000256707	0.914	Kinase D-interacting substrate of 220 kDa
17	9606.ENSP00000178640	0.913	Dual specificity mitogen-activated protein kinase kinase 5
18	9606.ENSP00000376345	0.913	Growth factor receptor-bound protein 2
19	9606.ENSP00000286827	0.911	T-lymphoma invasion and metastasis-inducing protein 1
20	9606.ENSP00000262995	0.907	GRB2-associated-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0098772	0.992	molecular function regulator activity
GO:0140677	0.979	molecular function activator activity
GO:0030546	0.963	signaling receptor activator activity
GO:0048018	0.947	receptor ligand activity
GO:0005126	0.842	cytokine receptor binding
GO:0008083	0.782	growth factor activity
GO:0019838	0.650	growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0009987	0.985	cellular process
GO:0048856	0.985	anatomical structure development
GO:0007399	0.982	nervous system development
GO:0019222	0.979	regulation of metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0080090	0.974	regulation of primary metabolic process
GO:0010941	0.974	regulation of cell death
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0048519	0.969	negative regulation of biological process
GO:0048523	0.963	negative regulation of cellular process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0009893	0.949	positive regulation of metabolic process
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0051173	0.941	positive regulation of nitrogen compound metabolic process
GO:0031325	0.935	positive regulation of cellular metabolic process
GO:0048583	0.917	regulation of response to stimulus
GO:0023052	0.910	signaling
GO:0007154	0.910	cell communication
GO:0023051	0.904	regulation of signaling
GO:0010646	0.904	regulation of cell communication
GO:0001934	0.891	positive regulation of protein phosphorylation
GO:0007422	0.884	peripheral nervous system development
GO:0043067	0.883	regulation of programmed cell death
GO:0051716	0.859	cellular response to stimulus
GO:0048869	0.851	cellular developmental process
GO:0051130	0.851	positive regulation of cellular component organization
GO:0007165	0.837	signal transduction
GO:0060548	0.831	negative regulation of cell death
GO:0065009	0.829	regulation of molecular function
GO:0048513	0.828	animal organ development
GO:0071840	0.827	cellular component organization or biogenesis
GO:0033135	0.827	regulation of peptidyl-serine phosphorylation
GO:0033138	0.817	positive regulation of peptidyl-serine phosphorylation
GO:0050793	0.816	regulation of developmental process
GO:0030154	0.800	cell differentiation
GO:0007166	0.788	cell surface receptor signaling pathway
GO:0043069	0.773	negative regulation of programmed cell death
GO:0045595	0.770	regulation of cell differentiation
GO:0016043	0.747	cellular component organization
GO:0051239	0.709	regulation of multicellular organismal process
GO:0009653	0.704	anatomical structure morphogenesis
GO:0022008	0.691	neurogenesis
GO:0009966	0.678	regulation of signal transduction
GO:0009605	0.669	response to external stimulus
GO:0006950	0.667	response to stress
GO:0051094	0.662	positive regulation of developmental process
GO:0042127	0.657	regulation of cell population proliferation
GO:0042981	0.649	regulation of apoptotic process
GO:0032990	0.644	cell part morphogenesis
GO:0045597	0.618	positive regulation of cell differentiation
GO:0051240	0.617	positive regulation of multicellular organismal process
GO:0050790	0.614	regulation of catalytic activity
GO:0044093	0.614	positive regulation of molecular function
GO:2000026	0.608	regulation of multicellular organismal development
GO:0048699	0.591	generation of neurons
GO:0048468	0.581	cell development
GO:0050769	0.564	positive regulation of neurogenesis
GO:0048584	0.527	positive regulation of response to stimulus
GO:1902531	0.527	regulation of intracellular signal transduction
GO:0051402	0.522	neuron apoptotic process
GO:0010468	0.517	regulation of gene expression
GO:0009967	0.515	positive regulation of signal transduction
GO:0007167	0.498	enzyme-linked receptor protein signaling pathway
GO:0007169	0.457	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0120036	0.439	plasma membrane bounded cell projection organization
GO:0048666	0.438	neuron development
GO:0042221	0.423	response to chemical
GO:0050804	0.392	modulation of chemical synaptic transmission
GO:1902533	0.392	positive regulation of intracellular signal transduction
GO:1901214	0.381	regulation of neuron death
GO:0000902	0.363	cell morphogenesis
GO:0045685	0.363	regulation of glial cell differentiation
GO:0031175	0.363	neuron projection development
GO:0008284	0.344	positive regulation of cell population proliferation
GO:0043085	0.334	positive regulation of catalytic activity
GO:0007267	0.323	cell-cell signaling
GO:0043410	0.315	positive regulation of MAPK cascade
GO:0040017	0.312	positive regulation of locomotion
GO:0040011	0.304	locomotion
GO:0009889	0.303	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.879	intracellular anatomical structure
GO:0043226	0.783	organelle
GO:0043227	0.746	membrane-bounded organelle
GO:0043229	0.737	intracellular organelle
GO:0043231	0.723	intracellular membrane-bounded organelle
GO:0005737	0.720	cytoplasm
GO:0070013	0.664	intracellular organelle lumen
GO:0012505	0.660	endomembrane system
GO:0005886	0.505	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]