StarFunc result for job id P20800

User Input

>input (178 residues)
MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECV
YFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGA
VPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20800	1.000	1.000	1.808E-26	178	1.000	1.000	P20800.pdb.gz	EDN2_HUMAN Endothelin-2 OS=Homo sapiens OX=9606 GN=EDN2 PE=1 SV=2
2	AFDB:P22389	0.347	0.352	1.600E-15	175	0.669	0.680	P22389.pdb.gz	EDN2_MOUSE Endothelin-2 OS=Mus musculus OX=10090 GN=Edn2 PE=2 SV=3
3	AFDB:P23943	0.391	0.394	1.600E-15	176	0.680	0.688	P23943.pdb.gz	EDN2_RAT Endothelin-2 OS=Rattus norvegicus OX=10116 GN=Edn2 PE=2 SV=2
4	AFDB:F4IUX6	0.148	0.035	2.410	1181	0.107	0.016	F4IUX6.pdb.gz	RENT2_ARATH Regulator of nonsense transcripts UPF2 OS=Arabidopsis thaliana OX=3702 GN=UPF2 PE=2 SV=1
5	AFDB:Q7X9I0	0.231	0.115	4.156	389	0.152	0.069	Q7X9I0.pdb.gz	AGL65_ARATH Agamous-like MADS-box protein AGL65 OS=Arabidopsis thaliana OX=3702 GN=AGL65 PE=1 SV=1
6	PDB:6wooL	0.148	0.136	4.267	198	0.129	0.116	6wooL.pdb.gz	An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
7	PDB:7ajtCL	0.204	0.059	4.267	781	0.096	0.022	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
8	AFDB:Q9FMD5	0.155	0.069	4.449	447	0.146	0.058	Q9FMD5.pdb.gz	TIC40_ARATH Protein TIC 40, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC40 PE=1 SV=1
9	AFDB:Q824H6	0.213	0.062	4.762	880	0.129	0.026	Q824H6.pdb.gz	Q824H6_CHLCV DUF1547 domain-containing protein OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=CCA_00170 PE=1 SV=1
10	AFDB:Q38BR4	0.139	0.072	5.098	349	0.180	0.092	Q38BR4.pdb.gz	Q38BR4_TRYB2 DDRGK domain-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4110 PE=4 SV=1
11	AFDB:P31955	0.125	0.091	5.842	248	0.135	0.097	P31955.pdb.gz	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
12	AFDB:Q91848	0.127	0.098	5.842	246	0.157	0.114	Q91848.pdb.gz	SIAM_XENLA Homeobox protein siamois OS=Xenopus laevis OX=8355 GN=siamois PE=1 SV=1
13	PDB:4v6wCC	0.169	0.081	6.421	392	0.096	0.043	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7mqaSI	0.198	0.052	7.359	803	0.135	0.030	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6v3fA	0.174	0.030	7.877	1234	0.084	0.012	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
16	PDB:6ud7D	0.114	0.259	8.433	73	0.101	0.247	6ud7D.pdb.gz	Structural basis of indisulam-mediated RBM39 recruitment to DCAF15 E3 ligase complex.
17	PDB:7rro2	0.085	0.062	9.664	292	0.124	0.075	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20800	6.06e-130	363	178	1.000	1.000	EDN2_HUMAN Endothelin-2 OS=Homo sapiens OX=9606 GN=EDN2 PE=1 SV=2
2	P23943	3.07e-76	227	176	0.669	0.676	EDN2_RAT Endothelin-2 OS=Rattus norvegicus OX=10116 GN=Edn2 PE=2 SV=2
3	P22389	2.50e-71	215	175	0.669	0.680	EDN2_MOUSE Endothelin-2 OS=Mus musculus OX=10090 GN=Edn2 PE=2 SV=3
4	Q9I8G3	2.95e-27	103	188	0.247	0.234	Q9I8G3_DANRE Endothelin 1 OS=Danio rerio OX=7955 GN=et-1 PE=2 SV=1
5	P22388	1.90e-25	99.0	202	0.365	0.322	EDN1_RAT Endothelin-1 OS=Rattus norvegicus OX=10116 GN=Edn1 PE=1 SV=2
6	P22387	4.72e-25	97.8	202	0.360	0.317	EDN1_MOUSE Endothelin-1 OS=Mus musculus OX=10090 GN=Edn1 PE=1 SV=3
7	P05305	6.22e-23	92.8	212	0.247	0.208	EDN1_HUMAN Endothelin-1 OS=Homo sapiens OX=9606 GN=EDN1 PE=1 SV=1
8	P13207	1.14e-21	88.2	167	0.281	0.299	EDN3_RAT Endothelin-3 OS=Rattus norvegicus OX=10116 GN=Edn3 PE=2 SV=3
9	P48299	3.08e-21	88.2	214	0.292	0.243	EDN3_MOUSE Endothelin-3 OS=Mus musculus OX=10090 GN=Edn3 PE=2 SV=1
10	E9QFS0	1.97e-20	84.7	153	0.253	0.294	E9QFS0_DANRE Endothelin 3b OS=Danio rerio OX=7955 GN=EDN3 PE=2 SV=1
11	P14138	3.48e-19	83.6	238	0.275	0.206	EDN3_HUMAN Endothelin-3 OS=Homo sapiens OX=9606 GN=EDN3 PE=1 SV=1
12	C0LGD8	0.70	32.7	864	0.107	0.022	Y1755_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07550 OS=Arabidopsis thaliana OX=3702 GN=At1g07550 PE=1 SV=1
13	Q936X2	4.6	30.0	605	0.107	0.031	ATZF_PSESD Allophanate hydrolase OS=Pseudomonas sp. (strain ADP) OX=47660 GN=atzF PE=1 SV=1
14	Q00963	4.9	30.0	2291	0.084	0.007	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
15	Q9NHX5	5.8	30.0	1178	0.067	0.010	Q9NHX5_DROME DESERT OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
16	E1JI78	8.0	29.6	2528	0.067	0.005	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
17	P75919	9.2	29.3	473	0.202	0.076	CLSC_ECOLI Cardiolipin synthase C OS=Escherichia coli (strain K12) OX=83333 GN=clsC PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00322 Endothelin	7.3e-20	81.4	Endothelin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315011	0.996	Endothelin-1 receptor
2	9606.ENSP00000366416	0.991	Endothelin receptor type B
3	9606.ENSP00000337128	0.841	Endothelin-3
4	9606.ENSP00000368683	0.836	Endothelin-1
5	9606.ENSP00000364028	0.667	Endothelin-converting enzyme 1
6	9606.ENSP00000384223	0.656	Endothelin-converting enzyme 2
7	9606.ENSP00000054668	0.653	Urotensin 2
8	9606.ENSP00000265023	0.645	Kininogen-1
9	9606.ENSP00000350198	0.636	Somatostatin receptor type 2
10	9606.ENSP00000305372	0.635	Beta-2 adrenergic receptor
11	9606.ENSP00000276414	0.632	Progonadoliberin-1
12	9606.ENSP00000354859	0.620	D(2) dopamine receptor
13	9606.ENSP00000349003	0.616	Prostaglandin E2 receptor EP3 subtype
14	9606.ENSP00000293897	0.610	Somatostatin receptor type 5
15	9606.ENSP00000245983	0.608	Progonadoliberin-2
16	9606.ENSP00000241256	0.600	Growth hormone secretagogue receptor type 1
17	9606.ENSP00000259455	0.600	Gamma-aminobutyric acid type B receptor subunit 2
18	9606.ENSP00000267377	0.600	Somatostatin receptor type 1
19	9606.ENSP00000296582	0.600	Transmembrane protein 184C
20	9606.ENSP00000306490	0.600	Muscarinic acetylcholine receptor M1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031708	1.000	endothelin B receptor binding
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.986	regulation of biological process
GO:0032501	0.982	multicellular organismal process
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.979	response to stimulus
GO:0044057	0.979	regulation of system process
GO:0007154	0.967	cell communication
GO:0032502	0.947	developmental process
GO:0048856	0.943	anatomical structure development
GO:0048518	0.941	positive regulation of biological process
GO:0051716	0.940	cellular response to stimulus
GO:0007165	0.931	signal transduction
GO:0065008	0.926	regulation of biological quality
GO:0003008	0.898	system process
GO:0048522	0.889	positive regulation of cellular process
GO:0051240	0.874	positive regulation of multicellular organismal process
GO:0007275	0.862	multicellular organism development
GO:0042221	0.860	response to chemical
GO:0008015	0.848	blood circulation
GO:0090257	0.836	regulation of muscle system process
GO:0070887	0.828	cellular response to chemical stimulus
GO:0010817	0.825	regulation of hormone levels
GO:0071704	0.818	organic substance metabolic process
GO:0097746	0.803	blood vessel diameter maintenance
GO:0044237	0.792	cellular metabolic process
GO:0006936	0.780	muscle contraction
GO:0048583	0.776	regulation of response to stimulus
GO:0006939	0.772	smooth muscle contraction
GO:0051046	0.771	regulation of secretion
GO:0003073	0.770	regulation of systemic arterial blood pressure
GO:0044238	0.768	primary metabolic process
GO:0006940	0.767	regulation of smooth muscle contraction
GO:0048731	0.747	system development
GO:1903522	0.735	regulation of blood circulation
GO:2000147	0.730	positive regulation of cell motility
GO:0050886	0.724	endocrine process
GO:0003044	0.701	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0040011	0.700	locomotion
GO:0065009	0.699	regulation of molecular function
GO:0010646	0.699	regulation of cell communication
GO:0045933	0.698	positive regulation of muscle contraction
GO:0023051	0.697	regulation of signaling
GO:0045987	0.691	positive regulation of smooth muscle contraction
GO:0050790	0.682	regulation of catalytic activity
GO:0030335	0.671	positive regulation of cell migration
GO:0044093	0.666	positive regulation of molecular function
GO:0048584	0.663	positive regulation of response to stimulus
GO:0008016	0.655	regulation of heart contraction
GO:0007186	0.652	G protein-coupled receptor signaling pathway
GO:0002376	0.640	immune system process
GO:0045823	0.629	positive regulation of heart contraction
GO:0051353	0.620	positive regulation of oxidoreductase activity
GO:0009605	0.615	response to external stimulus
GO:0006690	0.608	icosanoid metabolic process
GO:0048468	0.603	cell development
GO:0042330	0.597	taxis
GO:0006692	0.597	prostanoid metabolic process
GO:0042127	0.579	regulation of cell population proliferation
GO:0046456	0.577	icosanoid biosynthetic process
GO:0006636	0.577	unsaturated fatty acid biosynthetic process
GO:0009653	0.570	anatomical structure morphogenesis
GO:0001516	0.560	prostaglandin biosynthetic process
GO:0006935	0.551	chemotaxis
GO:0016477	0.526	cell migration
GO:0010033	0.510	response to organic substance
GO:0048519	0.488	negative regulation of biological process
GO:0032101	0.434	regulation of response to external stimulus
GO:0042310	0.406	vasoconstriction
GO:0050921	0.365	positive regulation of chemotaxis
GO:0071310	0.328	cellular response to organic substance
GO:0007166	0.304	cell surface receptor signaling pathway
GO:0048513	0.301	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.536	cell periphery
GO:0005886	0.513	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]