StarFunc result for job id P20809

User Input

>input (199 residues)
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20809	1.000	1.000	1.537E-26	199	1.000	1.000	P20809.pdb.gz	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
2	AFDB:P47873	0.843	0.843	3.290E-21	199	0.879	0.879	P47873.pdb.gz	IL11_MOUSE Interleukin-11 OS=Mus musculus OX=10090 GN=Il11 PE=1 SV=1
3	PDB:6o4oA	0.815	0.956	2.927E-19	169	0.844	0.994	6o4oA.pdb.gz
4	AFDB:P97712	0.673	0.630	2.688E-6	214	0.216	0.201	P97712.pdb.gz	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
5	AFDB:P83714	0.685	0.670	5.316E-6	204	0.231	0.225	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
6	AFDB:P09919	0.613	0.591	8.240E-6	207	0.231	0.222	P09919.pdb.gz	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
7	AFDB:Q9QZM3	0.706	0.631	1.200E-4	225	0.236	0.209	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
8	AFDB:P09920	0.660	0.633	1.260E-4	208	0.216	0.207	P09920.pdb.gz	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
9	AFDB:Q8K3I6	0.659	0.567	3.028E-4	234	0.206	0.175	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
10	AFDB:F1QP70	0.675	0.592	8.021E-4	231	0.186	0.160	F1QP70.pdb.gz
11	PDB:7u7nD	0.645	0.669	8.487E-4	191	0.201	0.209	7u7nD.pdb.gz
12	AFDB:P26441	0.668	0.665	8.842E-4	200	0.136	0.135	P26441.pdb.gz	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
13	PDB:1rhgB	0.539	0.731	4.234E-3	144	0.141	0.194	1rhgB.pdb.gz
14	PDB:1f6fA	0.642	0.689	4.667E-3	183	0.121	0.131	1f6fA.pdb.gz
15	PDB:7z0lB	0.632	0.351	6.563E-3	370	0.181	0.097	7z0lB.pdb.gz
16	PDB:1cnt1	0.517	0.663	9.690E-3	150	0.126	0.167	1cnt1.pdb.gz
17	PDB:7zxkC	0.647	0.764	1.431E-2	166	0.186	0.223	7zxkC.pdb.gz
18	PDB:1gncA	0.492	0.548	1.502E-2	175	0.206	0.234	1gncA.pdb.gz
19	PDB:1rw5A	0.617	0.617	1.825E-2	199	0.151	0.151	1rw5A.pdb.gz
20	PDB:3d48P	0.565	0.668	2.012E-2	165	0.131	0.158	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20809	4.38e-134	375	199	1.000	1.000	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
2	P47873	3.22e-102	295	199	0.879	0.879	IL11_MOUSE Interleukin-11 OS=Mus musculus OX=10090 GN=Il11 PE=1 SV=1
3	Q24JV0	0.21	32.7	104	0.090	0.173	Q24JV0_DANRE Zgc:136962 OS=Danio rerio OX=7955 GN=zgc:136962 PE=1 SV=1
4	Q57UD0	1.3	32.3	1803	0.186	0.021	Q57UD0_TRYB2 Kinesin K39, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.6C8.180 PE=3 SV=1
5	Q62839	2.0	31.6	998	0.141	0.028	GOGA2_RAT Golgin subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=4
6	Q8N3L3	3.6	30.8	684	0.176	0.051	TXLNB_HUMAN Beta-taxilin OS=Homo sapiens OX=9606 GN=TXLNB PE=1 SV=3
7	P83714	3.9	30.0	204	0.176	0.172	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
8	Q96JN2	5.3	30.4	1154	0.141	0.024	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
9	O75691	5.4	30.4	2785	0.095	0.007	UTP20_HUMAN Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3
10	Q7Z5R6	5.4	30.4	666	0.080	0.024	AB1IP_HUMAN Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Homo sapiens OX=9606 GN=APBB1IP PE=1 SV=1
11	Q921M4	6.0	30.0	999	0.136	0.027	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
12	Q5EAR7	9.8	28.9	207	0.101	0.097	Q5EAR7_DANRE BCL2 associated X, apoptosis regulator b OS=Danio rerio OX=7955 GN=zgc:112983 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07400 IL11	1.2e-55	199.3	Interleukin 11

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000450565	0.998	Interleukin-11 receptor subunit alpha
2	9606.ENSP00000296870	0.961	Interleukin-3
3	9606.ENSP00000370698	0.961	Interleukin-6 receptor subunit beta
4	9606.ENSP00000263409	0.865	Leukemia inhibitory factor receptor
5	9606.ENSP00000357470	0.845	Interleukin-6 receptor subunit alpha
6	9606.ENSP00000204615	0.836	Thrombopoietin
7	9606.ENSP00000385675	0.835	Interleukin-6
8	9606.ENSP00000274276	0.823	Oncostatin-M-specific receptor subunit beta
9	9606.ENSP00000296370	0.821	Protein S100-P
10	9606.ENSP00000215781	0.811	Oncostatin-M
11	9606.ENSP00000360730	0.807	Interleukin-13 receptor subunit alpha-1
12	9606.ENSP00000371067	0.805	Tyrosine-protein kinase JAK2
13	9606.ENSP00000343204	0.800	Tyrosine-protein kinase JAK1
14	9606.ENSP00000361548	0.792	Thrombopoietin receptor
15	9606.ENSP00000431885	0.792	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000279804	0.775	Cardiotrophin-1
17	9606.ENSP00000263379	0.774	Interleukin-27 receptor subunit alpha
18	9606.ENSP00000368265	0.772	Ciliary neurotrophic factor receptor subunit alpha
19	9606.ENSP00000249075	0.771	Leukemia inhibitory factor
20	9606.ENSP00000355370	0.759	Ciliary neurotrophic factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.995	growth factor activity
GO:0005126	0.898	cytokine receptor binding
GO:0005125	0.460	cytokine activity
GO:0070851	0.354	growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:0009893	0.987	positive regulation of metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0042127	0.984	regulation of cell population proliferation
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0008284	0.969	positive regulation of cell population proliferation
GO:0051246	0.951	regulation of protein metabolic process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0048583	0.936	regulation of response to stimulus
GO:0009987	0.915	cellular process
GO:0001932	0.911	regulation of protein phosphorylation
GO:0023051	0.897	regulation of signaling
GO:0010646	0.897	regulation of cell communication
GO:0031325	0.880	positive regulation of cellular metabolic process
GO:0051173	0.872	positive regulation of nitrogen compound metabolic process
GO:0048519	0.794	negative regulation of biological process
GO:0001934	0.770	positive regulation of protein phosphorylation
GO:0009966	0.769	regulation of signal transduction
GO:0050730	0.739	regulation of peptidyl-tyrosine phosphorylation
GO:0009967	0.718	positive regulation of signal transduction
GO:0010468	0.708	regulation of gene expression
GO:0048523	0.700	negative regulation of cellular process
GO:0031326	0.677	regulation of cellular biosynthetic process
GO:0019219	0.675	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.673	response to stimulus
GO:1902533	0.669	positive regulation of intracellular signal transduction
GO:0010556	0.655	regulation of macromolecule biosynthetic process
GO:0032879	0.630	regulation of localization
GO:0051049	0.608	regulation of transport
GO:0045893	0.592	positive regulation of DNA-templated transcription
GO:0006357	0.538	regulation of transcription by RNA polymerase II
GO:0050731	0.511	positive regulation of peptidyl-tyrosine phosphorylation
GO:0043410	0.485	positive regulation of MAPK cascade
GO:0065008	0.392	regulation of biological quality
GO:0023057	0.368	negative regulation of signaling
GO:0010648	0.368	negative regulation of cell communication
GO:0051046	0.358	regulation of secretion
GO:0051716	0.342	cellular response to stimulus
GO:1903530	0.334	regulation of secretion by cell
GO:0023052	0.331	signaling
GO:0007154	0.331	cell communication
GO:0045944	0.325	positive regulation of transcription by RNA polymerase II
GO:0007165	0.319	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0005737	0.982	cytoplasm
GO:0043226	0.793	organelle
GO:0070013	0.619	intracellular organelle lumen
GO:0071944	0.617	cell periphery
GO:0043227	0.617	membrane-bounded organelle
GO:0043231	0.569	intracellular membrane-bounded organelle
GO:0005886	0.531	plasma membrane
GO:0005829	0.493	cytosol
GO:0005615	0.362	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]