StarFunc result for job id P20810

User Input

>input (708 residues)
MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEH
TEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAI
SGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGP
EVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFT
CGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGT
RQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKP
KPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP
EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPD
YRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAIS
EVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAK
AEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDS
CPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12675	0.554	0.551	3.116E-70	713	0.790	0.784	P12675.pdb.gz	ICAL_PIG Calpastatin OS=Sus scrofa OX=9823 GN=CAST PE=1 SV=1
2	AFDB:P51125	0.506	0.464	1.199E-60	788	0.682	0.613	P51125.pdb.gz	ICAL_MOUSE Calpastatin OS=Mus musculus OX=10090 GN=Cast PE=1 SV=2
3	AFDB:P27321	0.295	0.294	2.991E-55	713	0.638	0.634	P27321.pdb.gz	ICAL_RAT Calpastatin OS=Rattus norvegicus OX=10116 GN=Cast PE=1 SV=3
4	AFDB:Q9BX66	0.041	0.029	2.532E-3	1292	0.169	0.093	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
5	AFDB:Q6AWX6	0.064	0.058	1.049E-2	821	0.117	0.101	Q6AWX6.pdb.gz	SCAR1_ARATH Protein SCAR1 OS=Arabidopsis thaliana OX=3702 GN=SCAR1 PE=1 SV=1
6	AFDB:Q17R98	0.053	0.038	2.653E-2	1081	0.179	0.117	Q17R98.pdb.gz	ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827 PE=1 SV=1
7	AFDB:Q8CBC4	0.050	0.050	3.614E-2	711	0.165	0.165	Q8CBC4.pdb.gz	CNST_MOUSE Consortin OS=Mus musculus OX=10090 GN=Cnst PE=1 SV=1
8	AFDB:K4H1X2	0.052	0.065	7.133E-2	547	0.114	0.148	K4H1X2.pdb.gz	K4H1X2_ALTBR Transcription factor Vf19 OS=Alternaria brassicicola OX=29001 PE=4 SV=1
9	AFDB:O35413	0.055	0.038	8.072E-2	1196	0.131	0.078	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
10	AFDB:Q10571	0.050	0.032	8.072E-2	1320	0.141	0.076	Q10571.pdb.gz	MN1_HUMAN Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3
11	PDB:6elzm	0.041	0.040	2.623	645	0.058	0.064	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
12	PDB:6yxyAE	0.041	0.064	2.623	434	0.034	0.055	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:6gmlU	0.044	0.110	6.631	183	0.028	0.109	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
14	PDB:7nacm	0.041	0.042	7.053	666	0.064	0.068	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:7s78R	0.031	0.162	9.608	101	0.032	0.228	7s78R.pdb.gz	Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGB5	0.0	1291	741	0.951	0.908	A0A0C4DGB5_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=2
2	B7Z574	0.0	1349	694	0.980	1.000	B7Z574_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
3	E7ES10	0.0	1254	642	0.907	1.000	E7ES10_HUMAN Calpastatin (Fragment) OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
4	E7EVY3	0.0	1342	693	0.979	1.000	E7EVY3_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
5	E9PCH5	0.0	1286	673	0.951	1.000	E9PCH5_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
6	E9PDE4	0.0	1144	636	0.898	1.000	E9PDE4_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
7	F8W7E0	0.0	588	393	0.438	0.789	F8W7E0_HUMAN Calpastatin (Fragment) OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
8	P12675	0.0	956	713	0.788	0.783	ICAL_PIG Calpastatin OS=Sus scrofa OX=9823 GN=CAST PE=1 SV=1
9	P20810	0.0	1379	708	1.000	1.000	ICAL_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4
10	P27321	0.0	727	713	0.624	0.620	ICAL_RAT Calpastatin OS=Rattus norvegicus OX=10116 GN=Cast PE=1 SV=3
11	P51125	0.0	799	788	0.682	0.613	ICAL_MOUSE Calpastatin OS=Mus musculus OX=10090 GN=Cast PE=1 SV=2
12	H0YA91	1.88e-147	433	301	0.331	0.777	H0YA91_HUMAN Calpastatin (Fragment) OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=1
13	M9PB30	6.3	32.7	22949	0.116	0.004	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
14	M9PC41	6.6	32.7	22743	0.116	0.004	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PC45	7.3	32.7	22300	0.116	0.004	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PBZ0	7.8	32.3	22830	0.116	0.004	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PEI1	9.3	32.3	21657	0.116	0.004	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00748 Calpain_inhib	3e-113	385.6	Calpain inhibitor
2	PF08383 Maf_N	3.5e+02	12.3	Maf N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009083

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000013652	0.979	Calpain 2, (m/II) large subunit
2	9593.ENSGGOP00000007591	0.952	Calpain 1, (mu/I) large subunit
3	9593.ENSGGOP00000003638	0.937	Calpain, small subunit 1
4	9593.ENSGGOP00000019492	0.899	Calpain 13
5	9593.ENSGGOP00000019593	0.882	Calpain 3, (p94)
6	9593.ENSGGOP00000007681	0.863	Calpain 6
7	9593.ENSGGOP00000012549	0.863	Calpain 9
8	9593.ENSGGOP00000026940	0.843	Calpain 5
9	9593.ENSGGOP00000024767	0.800	Calpain 10
10	9593.ENSGGOP00000018060	0.799	Calpain 7
11	9593.ENSGGOP00000019099	0.785	Calpain 11
12	9593.ENSGGOP00000028762	0.776	Calpain 8
13	9593.ENSGGOP00000016969	0.758	Calpain 15
14	9593.ENSGGOP00000021719	0.723	Calpain 14
15	9593.ENSGGOP00000007307	0.704	Uncharacterized protein
16	9593.ENSGGOP00000005792	0.688	Uncharacterized protein
17	9593.ENSGGOP00000004324	0.656	Uncharacterized protein
18	9593.ENSGGOP00000000915	0.643	Actin, alpha 1, skeletal muscle
19	9593.ENSGGOP00000005989	0.640	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
20	9593.ENSGGOP00000021868	0.634	Belongs to the protein kinase superfamily. Tyr protein kinase family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0010859	1.000	calcium-dependent cysteine-type endopeptidase inhibitor activity
GO:0003723	0.998	RNA binding
GO:0019899	0.959	enzyme binding
GO:0002020	0.926	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0051336	0.967	regulation of hydrolase activity
GO:0048519	0.942	negative regulation of biological process
GO:0019222	0.938	regulation of metabolic process
GO:0051246	0.928	regulation of protein metabolic process
GO:0043086	0.907	negative regulation of catalytic activity
GO:0060548	0.889	negative regulation of cell death
GO:0042981	0.843	regulation of apoptotic process
GO:0030162	0.821	regulation of proteolysis
GO:0071840	0.809	cellular component organization or biogenesis
GO:0016043	0.801	cellular component organization
GO:0043069	0.798	negative regulation of programmed cell death
GO:0051172	0.762	negative regulation of nitrogen compound metabolic process
GO:0010605	0.758	negative regulation of macromolecule metabolic process
GO:0034330	0.751	cell junction organization
GO:0010468	0.743	regulation of gene expression
GO:0052547	0.743	regulation of peptidase activity
GO:0045861	0.741	negative regulation of proteolysis
GO:0051346	0.718	negative regulation of hydrolase activity
GO:0070613	0.660	regulation of protein processing
GO:0043066	0.584	negative regulation of apoptotic process
GO:0010466	0.543	negative regulation of peptidase activity
GO:1904035	0.530	regulation of epithelial cell apoptotic process
GO:0010629	0.523	negative regulation of gene expression
GO:0008152	0.476	metabolic process
GO:0071704	0.432	organic substance metabolic process
GO:0048856	0.420	anatomical structure development
GO:0032501	0.404	multicellular organismal process
GO:1903318	0.404	negative regulation of protein maturation
GO:0006807	0.389	nitrogen compound metabolic process
GO:0044238	0.363	primary metabolic process
GO:0048518	0.359	positive regulation of biological process
GO:0043170	0.359	macromolecule metabolic process
GO:1901564	0.314	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.602	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]