StarFunc result for job id P20815

User Input

>input (502 residues)
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20815	1.000	1.000	2.392E-78	502	1.000	1.000	P20815.pdb.gz	CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens OX=9606 GN=CYP3A5 PE=1 SV=1
2	AFDB:P08684	0.991	0.989	2.804E-68	503	0.843	0.841	P08684.pdb.gz	CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4
3	AFDB:P24462	0.992	0.990	8.624E-68	503	0.819	0.817	P24462.pdb.gz	CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens OX=9606 GN=CYP3A7 PE=1 SV=3
4	PDB:5veuC	0.930	0.995	4.737E-67	469	0.934	1.000	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
5	AFDB:P79401	0.984	0.982	3.283E-66	503	0.759	0.757	P79401.pdb.gz	CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa OX=9823 GN=CYP3A29 PE=2 SV=1
6	AFDB:P24463	0.979	0.977	1.383E-65	503	0.783	0.781	P24463.pdb.gz	CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris OX=9615 GN=CYP3A12 PE=2 SV=1
7	AFDB:P51538	0.983	0.981	6.664E-65	503	0.751	0.750	P51538.pdb.gz	CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 GN=Cyp3a9 PE=2 SV=2
8	AFDB:Q9HB55	0.986	0.984	3.212E-64	503	0.757	0.755	Q9HB55.pdb.gz	CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens OX=9606 GN=CYP3A43 PE=1 SV=1
9	AFDB:Q64459	0.977	0.973	8.251E-64	504	0.731	0.728	Q64459.pdb.gz	CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus OX=10090 GN=Cyp3a11 PE=1 SV=1
10	AFDB:O09158	0.981	0.979	6.818E-63	503	0.711	0.710	O09158.pdb.gz	CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus OX=10090 GN=Cyp3a25 PE=1 SV=1
11	AFDB:P04800	0.981	0.977	4.924E-62	504	0.723	0.720	P04800.pdb.gz	CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus OX=10116 GN=Cyp3a1 PE=1 SV=1
12	PDB:5veuL	0.887	0.994	5.550E-61	448	0.892	1.000	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
13	PDB:5te8B	0.877	0.933	4.748E-55	471	0.787	0.839	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
14	PDB:7mk8B	0.881	0.949	7.441E-55	465	0.757	0.817	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
15	PDB:2j0dB	0.854	0.961	4.199E-52	445	0.747	0.843	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
16	PDB:7kvjA	0.808	0.975	2.620E-50	415	0.705	0.853	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
17	PDB:7n3mAAA	0.771	0.881	1.924E-22	437	0.209	0.240	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
18	PDB:3c6gB	0.768	0.822	3.015E-22	467	0.221	0.238	3c6gB.pdb.gz	Structural analysis of CYP2R1 in complex with vitamin D3.
19	PDB:3k9vA	0.778	0.838	5.656E-22	464	0.225	0.244	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
20	PDB:2vn0A	0.774	0.833	5.916E-22	464	0.217	0.235	2vn0A.pdb.gz	Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O09158	774	503	0.711	0.710	CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus OX=10090 GN=Cyp3a25 PE=1 SV=1
2	O42563	579	518	0.538	0.521	CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss OX=8022 GN=cyp3a27 PE=2 SV=1
3	P04800	767	504	0.725	0.722	CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus OX=10116 GN=Cyp3a1 PE=1 SV=1
4	P05183	752	504	0.709	0.706	CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus OX=10116 GN=Cyp3a2 PE=1 SV=2
5	P08684	863	503	0.843	0.841	CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4
6	P20815	1028	502	1.000	1.000	CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens OX=9606 GN=CYP3A5 PE=1 SV=1
7	P24462	843	503	0.819	0.817	CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens OX=9606 GN=CYP3A7 PE=1 SV=3
8	P24463	820	503	0.783	0.781	CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris OX=9615 GN=CYP3A12 PE=2 SV=1
9	P51538	793	503	0.751	0.750	CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 GN=Cyp3a9 PE=2 SV=2
10	P79401	811	503	0.759	0.757	CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa OX=9823 GN=CYP3A29 PE=2 SV=1
11	Q1PCR1	634	504	0.590	0.587	Q1PCR1_MELGA Cytochrome P450 3A OS=Meleagris gallopavo OX=9103 GN=CYP3A37 PE=2 SV=1
12	Q32LT1	566	517	0.536	0.520	Q32LT1_DANRE Cytochrome P450, family 3, subfamily A, polypeptide 65 OS=Danio rerio OX=7955 GN=zgc:123110 PE=2 SV=1
13	Q64459	799	504	0.731	0.728	CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus OX=10090 GN=Cyp3a11 PE=1 SV=1
14	Q64464	806	503	0.745	0.744	CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus OX=10090 GN=Cyp3a13 PE=1 SV=1
15	Q64581	751	497	0.679	0.686	CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus OX=10116 GN=Cyp3a18 PE=2 SV=1
16	Q86SK2	582	353	0.554	0.788	Q86SK2_HUMAN Cytochrome P450 OS=Homo sapiens OX=9606 GN=CYP3A43/CYP3A4 PE=2 SV=1
17	Q86SK3	886	503	0.837	0.835	Q86SK3_HUMAN Cytochrome P450 3A OS=Homo sapiens OX=9606 GN=CYP3A43/CYP3A4 PE=2 SV=1
18	Q8HZK1	803	503	0.767	0.765	Q8HZK1_CANLF Cytochrome P450 3A OS=Canis lupus familiaris OX=9615 PE=2 SV=1
19	Q90WD3	580	518	0.542	0.525	Q90WD3_ONCMY Cytochrome P450 3A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
20	Q9HB55	771	503	0.757	0.755	CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens OX=9606 GN=CYP3A43 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08695 Coa1	3.1e+02	12.5	Cytochrome oxidase complex assembly protein 1
2	PF00067 p450	1.6e-128	441.0	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222982

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260682	0.954	Cytochrome P450 2C9
2	9606.ENSP00000324648	0.952	Cytochrome P450 2B6
3	9606.ENSP00000360372	0.952	Cytochrome P450 2C19
4	9606.ENSP00000301141	0.950	Cytochrome P450 2A6
5	9606.ENSP00000369050	0.950	Cytochrome P450 1A1
6	9606.ENSP00000342007	0.948	Cytochrome P450 1A2
7	9606.ENSP00000480004	0.947	Epoxide hydrolase 1
8	9606.ENSP00000360958	0.946	Cytochrome P450 4A22
9	9606.ENSP00000332679	0.944	Cytochrome P450 2A13
10	9606.ENSP00000311095	0.943	Cytochrome P450 4A11
11	9606.ENSP00000379683	0.939	Aromatase
12	9606.ENSP00000199936	0.938	Estradiol 17-beta-dehydrogenase 2
13	9606.ENSP00000224356	0.935	Cytochrome P450 26A1
14	9606.ENSP00000226444	0.933	Estrogen sulfotransferase
15	9606.ENSP00000445122	0.933	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
16	9606.ENSP00000201586	0.932	Sulfotransferase family cytosolic 2B member 1
17	9606.ENSP00000358903	0.931	Steroid 17-alpha-hydroxylase/17,20 lyase
18	9606.ENSP00000001146	0.929	Cytochrome P450 26B1
19	9606.ENSP00000285949	0.929	Cytochrome P450 26C1
20	9606.ENSP00000308032	0.929	Cytochrome P450 2S1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008395	1.000	steroid hydroxylase activity
GO:0016705	0.996	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005488	0.960	binding
GO:0005515	0.909	protein binding
GO:0036094	0.405	small molecule binding
GO:0050649	0.313	testosterone 6-beta-hydroxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0050896	0.983	response to stimulus
GO:0065007	0.980	biological regulation
GO:1901360	0.956	organic cyclic compound metabolic process
GO:0042445	0.923	hormone metabolic process
GO:0006629	0.907	lipid metabolic process
GO:0006805	0.890	xenobiotic metabolic process
GO:0008202	0.876	steroid metabolic process
GO:0044281	0.866	small molecule metabolic process
GO:0006082	0.561	organic acid metabolic process
GO:0043436	0.515	oxoacid metabolic process
GO:0019752	0.435	carboxylic acid metabolic process
GO:0032787	0.433	monocarboxylic acid metabolic process
GO:0044255	0.397	cellular lipid metabolic process
GO:0120254	0.309	olefinic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031984	0.999	organelle subcompartment
GO:0005783	0.999	endoplasmic reticulum
GO:0042175	0.998	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031090	0.997	organelle membrane
GO:0005789	0.988	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:43836	1.000	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.-.-	0.996	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]