StarFunc result for job id P20823

User Input

>input (631 residues)
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAEL
PNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVK
SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA
GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE
CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALP
AHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSH
SLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA
SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPV
QSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTK
QVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQS
SDSSNGQSHLLPSNHSVIETFISTQMASSSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20823	0.999	0.999	6.018E-71	631	1.000	1.000	P20823.pdb.gz	HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A PE=1 SV=2
2	AFDB:E0YMJ6	0.331	0.389	1.166E-35	531	0.487	0.578	E0YMJ6.pdb.gz	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
3	AFDB:Q9UIU6	0.089	0.074	5.777E-4	781	0.204	0.165	Q9UIU6.pdb.gz	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
4	AFDB:M9PBJ7	0.057	0.033	3.792E-2	1213	0.128	0.067	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
5	AFDB:D3ZAX5	0.063	0.049	5.597E-2	935	0.151	0.102	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
6	AFDB:Q9W002	0.059	0.039	7.139E-2	1504	0.132	0.055	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
7	AFDB:P31264	0.106	0.088	1.106E-1	782	0.154	0.124	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
8	AFDB:Q7SXA7	0.056	0.053	1.280E-1	678	0.163	0.152	Q7SXA7.pdb.gz
9	AFDB:Q13625	0.060	0.040	1.555E-1	1128	0.187	0.105	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
10	AFDB:Q59DP0	0.113	0.107	2.082E-1	680	0.120	0.112	Q59DP0.pdb.gz	Q59DP0_DROME Shaven, isoform D OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=1
11	PDB:3dnvB	0.082	0.590	1.398	71	0.019	0.169	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
12	PDB:7pubCI	0.055	0.078	2.274	427	0.038	0.056	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
13	PDB:1b0nA	0.080	0.369	2.388	103	0.024	0.146	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
14	PDB:6hizCI	0.061	0.158	2.388	222	0.019	0.054	6hizCI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7xeyA	0.060	0.061	2.388	614	0.036	0.037	7xeyA.pdb.gz	Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity.
16	PDB:6dv9F	0.066	0.175	2.632	174	0.063	0.230	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
17	PDB:7r5jL0	0.062	0.054	2.901	782	0.036	0.029	7r5jL0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:6z5lA	0.072	0.146	3.356	251	0.036	0.092	6z5lA.pdb.gz
19	PDB:4jhjA	0.077	0.155	3.524	216	0.041	0.120	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
20	PDB:5b5rA	0.079	0.107	3.699	409	0.033	0.051	5b5rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E0YMJ6	0.0	561	531	0.491	0.584	E0YMJ6_HUMAN HNF1 beta A splice variant 1 OS=Homo sapiens OX=9606 GN=HNF1B PE=2 SV=1
2	P15257	0.0	1115	628	0.945	0.949	HNF1A_RAT Hepatocyte nuclear factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hnf1a PE=1 SV=1
3	P20823	0.0	1269	631	1.000	1.000	HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A PE=1 SV=2
4	P22361	0.0	1117	628	0.948	0.952	HNF1A_MOUSE Hepatocyte nuclear factor 1-alpha OS=Mus musculus OX=10090 GN=Hnf1a PE=1 SV=2
5	P23899	0.0	561	557	0.502	0.569	HNF1B_RAT Hepatocyte nuclear factor 1-beta OS=Rattus norvegicus OX=10116 GN=Hnf1b PE=1 SV=1
6	P27889	0.0	556	558	0.501	0.566	HNF1B_MOUSE Hepatocyte nuclear factor 1-beta OS=Mus musculus OX=10090 GN=Hnf1b PE=1 SV=2
7	P35680	0.0	555	557	0.498	0.564	HNF1B_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
8	Q6FHW6	0.0	555	557	0.498	0.564	Q6FHW6_HUMAN TCF2 protein OS=Homo sapiens OX=9606 GN=TCF2 PE=2 SV=1
9	A0A087WZC2	5.19e-178	518	548	0.471	0.542	A0A087WZC2_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
10	Q8UVH4	7.68e-178	518	560	0.499	0.562	Q8UVH4_DANRE HNF1 homeobox a OS=Danio rerio OX=7955 GN=tcf1 PE=2 SV=1
11	A1L1N5	3.99e-174	508	559	0.475	0.537	HN1BA_DANRE Hepatocyte nuclear factor 1-beta-A OS=Danio rerio OX=7955 GN=hnf1ba PE=2 SV=2
12	A0A0C4DGS8	7.69e-160	468	457	0.404	0.558	A0A0C4DGS8_HUMAN HNF1 homeobox B OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
13	Q8UW00	1.68e-147	439	532	0.445	0.528	HN1BB_DANRE Hepatocyte nuclear factor 1-beta-B OS=Danio rerio OX=7955 GN=hnf1bb PE=2 SV=1
14	E0YMJ8	1.88e-139	415	425	0.366	0.544	E0YMJ8_HUMAN HNF1 beta A splice variant 3 OS=Homo sapiens OX=9606 GN=HNF1B PE=1 SV=1
15	A0A087WXS2	2.49e-80	257	293	0.228	0.491	A0A087WXS2_HUMAN Hepatocyte nuclear factor 1-beta OS=Homo sapiens OX=9606 GN=HNF1B PE=4 SV=1
16	Q8BJA3	7.51e-14	76.3	419	0.092	0.138	HMBX1_MOUSE Homeobox-containing protein 1 OS=Mus musculus OX=10090 GN=Hmbox1 PE=1 SV=1
17	E5RGZ2	2.20e-13	74.7	386	0.092	0.150	E5RGZ2_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
18	Q6NT76	3.20e-13	74.3	420	0.086	0.129	HMBX1_HUMAN Homeobox-containing protein 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
19	H0YKJ1	4.97e-13	73.6	396	0.089	0.141	H0YKJ1_HUMAN Homeobox containing 1 OS=Homo sapiens OX=9606 GN=HMBOX1 PE=1 SV=1
20	Q9TYT0	4.93e-07	55.1	424	0.067	0.099	HMBX1_CAEEL Homeobox-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=hmbx-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04813 HNF-1A_C	1e-38	143.2	Hepatocyte nuclear factor 1 (HNF-1), alpha isoform C terminus
2	PF04812 HNF-1B_C	1.3e-109	377.4	Hepatocyte nuclear factor 1 (HNF-1), beta isoform C terminus
3	PF04814 HNF-1_N	9.6e-54	194.2	Hepatocyte nuclear factor 1 (HNF-1), N terminus
4	PF05920 Homeobox_KN	1.4e+02	13.8	Homeobox KN domain
5	PF00046 Homeodomain	0.34	22.1	Homeodomain
6	PF09470 Telethonin	7.6	17.9	Telethonin protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299299	0.998	Pterin-4-alpha-carbinolamine dehydratase
2	9606.ENSP00000312987	0.989	Hepatocyte nuclear factor 4-alpha
3	9606.ENSP00000262367	0.983	CREB-binding protein
4	9606.ENSP00000344456	0.981	Catenin beta-1
5	9606.ENSP00000304004	0.963	Hepatocyte nuclear factor 3-gamma
6	9606.ENSP00000323568	0.962	Solute carrier family 2, facilitated glucose transporter member 2
7	9606.ENSP00000379701	0.958	Hepatocyte nuclear factor 4-gamma
8	9606.ENSP00000263253	0.957	Histone acetyltransferase p300
9	9606.ENSP00000339933	0.952	Pyruvate kinase PKLR
10	9606.ENSP00000421544	0.949	Pterin-4-alpha-carbinolamine dehydratase 2
11	9606.ENSP00000479618	0.944	Myc proto-oncogene protein
12	9606.ENSP00000221561	0.936	Amino-terminal enhancer of split
13	9606.ENSP00000227507	0.929	G1/S-specific cyclin-D1
14	9606.ENSP00000362649	0.926	Histone deacetylase 1
15	9606.ENSP00000263025	0.923	Mitogen-activated protein kinase 3
16	9606.ENSP00000265354	0.919	Serum response factor
17	9606.ENSP00000365682	0.919	Transducin-like enhancer protein 1
18	9606.ENSP00000310928	0.914	Peroxisome proliferator-activated receptor delta
19	9606.ENSP00000341551	0.913	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000378974	0.913	Mitogen-activated protein kinase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0046983	1.000	protein dimerization activity
GO:0042802	1.000	identical protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0042803	0.935	protein homodimerization activity
GO:0046982	0.905	protein heterodimerization activity
GO:0000981	0.896	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.541	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.408	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.994	regulation of gene expression
GO:0031326	0.993	regulation of cellular biosynthetic process
GO:0019219	0.993	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.989	cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0009893	0.966	positive regulation of metabolic process
GO:0045944	0.956	positive regulation of transcription by RNA polymerase II
GO:0065008	0.945	regulation of biological quality
GO:0032501	0.926	multicellular organismal process
GO:0050896	0.863	response to stimulus
GO:0023052	0.827	signaling
GO:0007154	0.827	cell communication
GO:0032502	0.690	developmental process
GO:0048856	0.684	anatomical structure development
GO:0051716	0.634	cellular response to stimulus
GO:0042221	0.618	response to chemical
GO:0071704	0.607	organic substance metabolic process
GO:0051179	0.601	localization
GO:0048519	0.573	negative regulation of biological process
GO:0044237	0.550	cellular metabolic process
GO:0048523	0.549	negative regulation of cellular process
GO:0044238	0.515	primary metabolic process
GO:0010033	0.484	response to organic substance
GO:0042592	0.482	homeostatic process
GO:0048513	0.468	animal organ development
GO:0048731	0.458	system development
GO:0048878	0.413	chemical homeostasis
GO:0009892	0.395	negative regulation of metabolic process
GO:0006807	0.394	nitrogen compound metabolic process
GO:0051234	0.385	establishment of localization
GO:0006810	0.383	transport
GO:0010605	0.359	negative regulation of macromolecule metabolic process
GO:0033500	0.344	carbohydrate homeostasis
GO:0010817	0.342	regulation of hormone levels
GO:0031324	0.342	negative regulation of cellular metabolic process
GO:0042593	0.331	glucose homeostasis
GO:0051172	0.325	negative regulation of nitrogen compound metabolic process
GO:0023051	0.324	regulation of signaling
GO:0010646	0.322	regulation of cell communication
GO:1901700	0.321	response to oxygen-containing compound
GO:0070887	0.313	cellular response to chemical stimulus
GO:0007267	0.311	cell-cell signaling
GO:0033036	0.308	macromolecule localization
GO:0071702	0.308	organic substance transport
GO:0048583	0.305	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.989	protein-containing complex
GO:0005737	0.954	cytoplasm
GO:0031981	0.917	nuclear lumen
GO:0005654	0.876	nucleoplasm
GO:0043232	0.329	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]