StarFunc result for job id P20827

User Input

>input (205 residues)
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20827	1.000	1.000	2.431E-43	205	1.000	1.000	P20827.pdb.gz	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
2	AFDB:P52793	0.723	0.723	6.855E-37	205	0.859	0.859	P52793.pdb.gz	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
3	AFDB:O08543	0.661	0.599	4.115E-22	228	0.439	0.395	O08543.pdb.gz	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
4	AFDB:A0A0B5JK29	0.630	0.743	8.333E-21	173	0.351	0.416	A0A0B5JK29.pdb.gz
5	AFDB:A0A0B5JFB8	0.627	0.661	1.882E-20	194	0.410	0.433	A0A0B5JFB8.pdb.gz
6	AFDB:P79728	0.639	0.578	3.992E-20	228	0.400	0.360	P79728.pdb.gz	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
7	AFDB:P52797	0.653	0.569	1.796E-19	238	0.405	0.349	P52797.pdb.gz	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
8	AFDB:O43921	0.615	0.593	2.168E-19	213	0.351	0.338	O43921.pdb.gz	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
9	AFDB:Q98TZ1	0.640	0.649	2.069E-18	202	0.346	0.351	Q98TZ1.pdb.gz	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:P52798	0.611	0.622	6.005E-18	201	0.371	0.378	P52798.pdb.gz	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
11	PDB:4v96AA	0.266	0.203	1.279E-3	299	0.083	0.057	4v96AA.pdb.gz
12	PDB:2aanA	0.314	0.456	2.713E-3	123	0.107	0.179	2aanA.pdb.gz	The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
13	PDB:6cjzA	0.252	0.426	1.221E-2	105	0.088	0.171	6cjzA.pdb.gz
14	PDB:2nnrA	0.236	0.392	1.384E-2	110	0.073	0.136	2nnrA.pdb.gz
15	PDB:4bxsV	0.274	0.064	2.757E-2	1262	0.102	0.017	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
16	PDB:6mjrA	0.281	0.398	4.275E-2	128	0.068	0.109	6mjrA.pdb.gz	Two Tryptophans Are Better Than One in Accelerating Electron Flow through a Protein.
17	PDB:7d4yB	0.245	0.106	4.552E-2	601	0.073	0.025	7d4yB.pdb.gz
18	PDB:5n4lA	0.263	0.069	4.846E-2	1034	0.063	0.013	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
19	PDB:2bo0A	0.290	0.188	5.160E-2	336	0.102	0.062	2bo0A.pdb.gz	High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
20	PDB:3oaiA	0.246	0.121	6.227E-2	488	0.054	0.023	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20827	2.34e-155	429	205	1.000	1.000	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2
2	P97553	1.72e-128	362	205	0.863	0.863	EFNA1_RAT Ephrin-A1 OS=Rattus norvegicus OX=10116 GN=Efna1 PE=2 SV=2
3	P52793	4.78e-128	360	205	0.815	0.815	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
4	P52803	1.23e-44	150	228	0.356	0.320	EFNA5_HUMAN Ephrin-A5 OS=Homo sapiens OX=9606 GN=EFNA5 PE=1 SV=1
5	P97605	4.21e-44	148	228	0.351	0.316	EFNA5_RAT Ephrin-A5 OS=Rattus norvegicus OX=10116 GN=Efna5 PE=1 SV=2
6	O08543	5.12e-44	148	228	0.351	0.316	EFNA5_MOUSE Ephrin-A5 OS=Mus musculus OX=10090 GN=Efna5 PE=1 SV=1
7	P79728	2.23e-43	146	228	0.346	0.311	EFNA5_DANRE Ephrin-A5b OS=Danio rerio OX=7955 GN=efna5b PE=1 SV=1
8	A0A8I5ZVQ1	4.76e-43	145	204	0.376	0.377	A0A8I5ZVQ1_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=1
9	A0A0G2JV56	8.43e-43	145	230	0.400	0.357	A0A0G2JV56_RAT Ephrin A3 OS=Rattus norvegicus OX=10116 GN=Efna3 PE=3 SV=2
10	O08545	8.43e-43	145	230	0.400	0.357	EFNA3_MOUSE Ephrin-A3 OS=Mus musculus OX=10090 GN=Efna3 PE=1 SV=4
11	P52797	1.20e-41	142	238	0.400	0.345	EFNA3_HUMAN Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3 PE=1 SV=1
12	F1MA19	3.18e-41	140	209	0.346	0.340	F1MA19_RAT Ephrin A2 OS=Rattus norvegicus OX=10116 GN=Efna2 PE=3 SV=1
13	P52801	3.18e-41	140	209	0.346	0.340	EFNA2_MOUSE Ephrin-A2 OS=Mus musculus OX=10090 GN=Efna2 PE=1 SV=1
14	O43921	2.57e-40	138	213	0.390	0.376	EFNA2_HUMAN Ephrin-A2 OS=Homo sapiens OX=9606 GN=EFNA2 PE=1 SV=1
15	Q98TZ1	7.53e-40	137	202	0.327	0.332	Q98TZ1_CHICK Ephrin-A6 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
16	P52798	2.22e-35	125	201	0.332	0.338	EFNA4_HUMAN Ephrin-A4 OS=Homo sapiens OX=9606 GN=EFNA4 PE=1 SV=1
17	P98172	1.66e-13	70.1	346	0.234	0.139	EFNB1_HUMAN Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1
18	P52795	1.68e-13	70.1	345	0.234	0.139	EFNB1_MOUSE Ephrin-B1 OS=Mus musculus OX=10090 GN=Efnb1 PE=1 SV=1
19	O73874	4.69e-13	68.6	332	0.185	0.114	EFNB2_DANRE Ephrin-B2a OS=Danio rerio OX=7955 GN=efnb2a PE=1 SV=1
20	A0A8I6AJ66	4.88e-13	68.6	305	0.259	0.174	A0A8I6AJ66_RAT Ephrin B2 OS=Rattus norvegicus OX=10116 GN=Efnb2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00812 Ephrin	2.5e-49	178.4	Ephrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357392

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275815	0.999	Ephrin type-A receptor 1
2	9606.ENSP00000281821	0.999	Ephrin type-A receptor 4
3	9606.ENSP00000351209	0.999	Ephrin type-A receptor 2
4	9606.ENSP00000337451	0.995	Ephrin type-A receptor 3
5	9606.ENSP00000264051	0.960	Ephexin-1
6	9606.ENSP00000362139	0.957	Ephrin type-A receptor 10
7	9606.ENSP00000381097	0.952	Ephrin type-B receptor 1
8	9606.ENSP00000362680	0.947	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000264033	0.944	E3 ubiquitin-protein ligase CBL
10	9606.ENSP00000400175	0.943	Transforming protein RhoA
11	9606.ENSP00000359073	0.940	Guanine nucleotide exchange factor VAV3
12	9606.ENSP00000272067	0.938	Low molecular weight phosphotyrosine protein phosphatase
13	9606.ENSP00000360916	0.938	Guanine nucleotide exchange factor VAV2
14	9606.ENSP00000261769	0.936	Cadherin-1
15	9606.ENSP00000391669	0.929	Breast cancer anti-estrogen resistance protein 1
16	9606.ENSP00000341189	0.928	Focal adhesion kinase 1
17	9606.ENSP00000346671	0.928	Tyrosine-protein kinase Fyn
18	9606.ENSP00000286827	0.926	T-lymphoma invasion and metastasis-inducing protein 1
19	9606.ENSP00000355026	0.926	Rho guanine nucleotide exchange factor 15
20	9606.ENSP00000344456	0.925	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046875	0.999	ephrin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007169	0.990	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.987	regulation of metabolic process
GO:0032501	0.983	multicellular organismal process
GO:0048519	0.980	negative regulation of biological process
GO:0048518	0.980	positive regulation of biological process
GO:0048856	0.979	anatomical structure development
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0048013	0.976	ephrin receptor signaling pathway
GO:0048522	0.974	positive regulation of cellular process
GO:0007275	0.971	multicellular organism development
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0080090	0.958	regulation of primary metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0042325	0.935	regulation of phosphorylation
GO:0001932	0.934	regulation of protein phosphorylation
GO:0001934	0.919	positive regulation of protein phosphorylation
GO:0050730	0.915	regulation of peptidyl-tyrosine phosphorylation
GO:0065008	0.910	regulation of biological quality
GO:0051336	0.885	regulation of hydrolase activity
GO:0048583	0.876	regulation of response to stimulus
GO:0023051	0.865	regulation of signaling
GO:0010646	0.864	regulation of cell communication
GO:0007155	0.838	cell adhesion
GO:0044093	0.838	positive regulation of molecular function
GO:0043085	0.834	positive regulation of catalytic activity
GO:0030155	0.816	regulation of cell adhesion
GO:0048731	0.814	system development
GO:0009966	0.814	regulation of signal transduction
GO:0048523	0.802	negative regulation of cellular process
GO:0051338	0.787	regulation of transferase activity
GO:0050793	0.762	regulation of developmental process
GO:0010605	0.742	negative regulation of macromolecule metabolic process
GO:0051172	0.737	negative regulation of nitrogen compound metabolic process
GO:0050731	0.724	positive regulation of peptidyl-tyrosine phosphorylation
GO:0048870	0.698	cell motility
GO:0043549	0.693	regulation of kinase activity
GO:0030162	0.664	regulation of proteolysis
GO:0010941	0.611	regulation of cell death
GO:0040012	0.603	regulation of locomotion
GO:0051128	0.603	regulation of cellular component organization
GO:0031589	0.594	cell-substrate adhesion
GO:1902531	0.588	regulation of intracellular signal transduction
GO:1902991	0.580	regulation of amyloid precursor protein catabolic process
GO:0030334	0.576	regulation of cell migration
GO:0016477	0.568	cell migration
GO:0051248	0.550	negative regulation of protein metabolic process
GO:0051345	0.548	positive regulation of hydrolase activity
GO:0048584	0.547	positive regulation of response to stimulus
GO:0051347	0.545	positive regulation of transferase activity
GO:0051239	0.528	regulation of multicellular organismal process
GO:0033674	0.525	positive regulation of kinase activity
GO:0034446	0.478	substrate adhesion-dependent cell spreading
GO:0042981	0.467	regulation of apoptotic process
GO:0045859	0.465	regulation of protein kinase activity
GO:0048513	0.440	animal organ development
GO:0052547	0.438	regulation of peptidase activity
GO:0033628	0.422	regulation of cell adhesion mediated by integrin
GO:0010647	0.421	positive regulation of cell communication
GO:0009653	0.418	anatomical structure morphogenesis
GO:0023056	0.416	positive regulation of signaling
GO:0030154	0.413	cell differentiation
GO:0042221	0.412	response to chemical
GO:0072359	0.401	circulatory system development
GO:1902533	0.392	positive regulation of intracellular signal transduction
GO:0022603	0.353	regulation of anatomical structure morphogenesis
GO:0071840	0.330	cellular component organization or biogenesis
GO:0045860	0.327	positive regulation of protein kinase activity
GO:0010468	0.319	regulation of gene expression
GO:0008152	0.311	metabolic process
GO:0070887	0.311	cellular response to chemical stimulus
GO:0040017	0.307	positive regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005829	0.422	cytosol
GO:0043231	0.368	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]