StarFunc result for job id P20839

User Input

>input (514 residues)
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GMG5	0.999	0.944	0.000	544	0.905	0.855	Q6GMG5.pdb.gz	IMDH1_DANRE Inosine-5'-monophosphate dehydrogenase 1a OS=Danio rerio OX=7955 GN=impdh1a PE=2 SV=1
2	AFDB:A0A384N6C2	0.994	0.994	1.133E-102	514	0.840	0.840	A0A384N6C2.pdb.gz	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
3	AFDB:H0Y4R1	0.983	0.939	1.143E-100	538	0.839	0.801	H0Y4R1.pdb.gz	H0Y4R1_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
4	PDB:7rfgA	0.947	0.991	3.286E-99	491	0.953	0.998	7rfgA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
5	AFDB:E7ETK5	0.922	0.969	5.169E-93	489	0.794	0.834	E7ETK5.pdb.gz	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
6	AFDB:Q07152	0.954	0.913	2.586E-89	537	0.685	0.655	Q07152.pdb.gz	IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ras PE=1 SV=1
7	AFDB:P50094	0.959	0.941	2.193E-86	524	0.619	0.607	P50094.pdb.gz	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
8	AFDB:P38697	0.957	0.941	2.469E-86	523	0.595	0.585	P38697.pdb.gz	IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD2 PE=1 SV=1
9	AFDB:Q59Q46	0.959	0.947	5.349E-85	521	0.621	0.612	Q59Q46.pdb.gz	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2
10	AFDB:Q6FM59	0.956	0.932	9.110E-85	527	0.603	0.588	Q6FM59.pdb.gz	Q6FM59_CANGA Inosine-5'-monophosphate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K10780g PE=3 SV=1
11	AFDB:O14344	0.965	0.947	1.025E-84	524	0.591	0.580	O14344.pdb.gz	IMDH_SCHPO Inosine-5'-monophosphate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gua1 PE=2 SV=1
12	PDB:6i0mA	0.863	0.985	2.973E-81	450	0.745	0.851	6i0mA.pdb.gz	A Nucleotide-Dependent Conformational Switch Controls the Polymerization of Human IMP Dehydrogenases to Modulate their Catalytic Activity.
13	PDB:6uajA	0.934	0.981	8.659E-80	489	0.802	0.843	6uajA.pdb.gz	Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.
14	PDB:1nf7A	0.737	0.826	3.848E-76	454	0.753	0.852	1nf7A.pdb.gz	Crystal Structure of Human Inosine Monophosphate Dehydrogenase type II complexed with the MPA/NAD analog C2-MAD
15	PDB:7rglA	0.739	0.908	1.598E-74	416	0.790	0.976	7rglA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
16	PDB:7rerA	0.727	0.959	4.136E-73	389	0.751	0.992	7rerA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
17	PDB:7rfhH	0.729	0.821	8.447E-72	451	0.844	0.962	7rfhH.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
18	PDB:1jcnA	0.657	0.836	1.984E-65	395	0.749	0.975	1jcnA.pdb.gz	Crystal Structure of the Human Type I Inosine Monophosphate Dehydrogenase and Implications for Isoform Specificity
19	PDB:1b3oB	0.631	0.787	2.105E-65	410	0.685	0.859	1b3oB.pdb.gz	Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
20	PDB:7rgiA	0.684	0.983	3.240E-61	357	0.691	0.994	7rgiA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384N6C2	907	514	0.840	0.840	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
2	A0A3B3IRL5	954	509	0.916	0.925	A0A3B3IRL5_HUMAN Inosine-5'-monophosphate dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=1
3	B0UXP9	887	514	0.819	0.819	IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio OX=7955 GN=impdh2 PE=3 SV=1
4	C9J381	1044	513	0.998	1.000	C9J381_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=1
5	D3ZLZ7	1033	514	0.982	0.982	IMDH1_RAT Inosine-5'-monophosphate dehydrogenase 1 OS=Rattus norvegicus OX=10116 GN=Impdh1 PE=3 SV=1
6	E7ETK5	840	489	0.794	0.834	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
7	E9PU28	910	514	0.842	0.842	IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1
8	F1DBB2	580	527	0.580	0.565	MPAF_PENBR Inosine-5'-monophosphate dehydrogenase OS=Penicillium brevicompactum OX=5074 GN=mpaF PE=3 SV=1
9	H0Y4R1	893	538	0.840	0.803	H0Y4R1_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
10	O14344	614	524	0.591	0.580	IMDH_SCHPO Inosine-5'-monophosphate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gua1 PE=2 SV=1
11	P12268	907	514	0.840	0.840	IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
12	P20839	1050	514	1.000	1.000	IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1 PE=1 SV=2
13	P24547	906	514	0.840	0.840	IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus OX=10090 GN=Impdh2 PE=1 SV=2
14	P38697	647	523	0.595	0.585	IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD2 PE=1 SV=1
15	P50094	660	524	0.621	0.609	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
16	P50095	636	523	0.609	0.598	IMDH3_YEAST Inosine-5'-monophosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD3 PE=1 SV=1
17	P50096	1033	514	0.981	0.981	IMDH1_MOUSE Inosine-5'-monophosphate dehydrogenase 1 OS=Mus musculus OX=10090 GN=Impdh1 PE=1 SV=2
18	Q07152	729	537	0.681	0.652	IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ras PE=1 SV=1
19	Q54QQ0	632	515	0.605	0.604	IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=impdh PE=1 SV=1
20	Q59Q46	642	521	0.623	0.614	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00571 CBS	4.7e-12	57.5	CBS domain
2	PF01180 DHO_dh	56	14.4	Dihydroorotate dehydrogenase
3	PF01207 Dus	84	13.7	Dihydrouridine synthase (Dus)
4	PF01070 FMN_dh	2.2e-06	38.5	FMN-dependent dehydrogenase
5	PF04309 G3P_antiterm	2.3e+02	12.6	Glycerol-3-phosphate responsive antiterminator
6	PF01645 Glu_synthase	4.3	18.0	Conserved region in glutamate synthase
7	PF00977 His_biosynth	0.036	25.1	Histidine biosynthesis protein
8	PF00478 IMPDH	9e-137	467.3	IMP dehydrogenase / GMP reductase domain
9	PF04131 NanE	1.1	19.9	Putative N-acetylmannosamine-6-phosphate epimerase
10	PF03060 NMO	6.1e-08	44.0	Nitronate monooxygenase
11	PF05690 ThiG	2.6	18.8	Thiazole biosynthesis protein ThiG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419851	0.997	GMP synthase [glutamine-hydrolyzing]
2	9606.ENSP00000321584	0.974	Inosine-5'-monophosphate dehydrogenase 2
3	9606.ENSP00000355493	0.969	Adenylosuccinate synthetase isozyme 2
4	9606.ENSP00000236959	0.955	Bifunctional purine biosynthesis protein PURH
5	9606.ENSP00000369456	0.949	Inosine triphosphate pyrophosphatase
6	9606.ENSP00000256578	0.948	AMP deaminase 2
7	9606.ENSP00000333019	0.948	Adenylosuccinate synthetase isozyme 1
8	9606.ENSP00000298556	0.946	Hypoxanthine-guanine phosphoribosyltransferase
9	9606.ENSP00000312304	0.944	Thiopurine S-methyltransferase
10	9606.ENSP00000379802	0.943	AMP deaminase 3
11	9606.ENSP00000361704	0.942	CTP synthase 1
12	9606.ENSP00000430075	0.940	AMP deaminase 1
13	9606.ENSP00000257770	0.928	5'-nucleotidase
14	9606.ENSP00000259727	0.919	GMP reductase 1
15	9606.ENSP00000360250	0.916	Ectonucleoside triphosphate diphosphohydrolase 1
16	9606.ENSP00000339479	0.915	Cytosolic purine 5'-nucleotidase
17	9606.ENSP00000301825	0.913	Ectonucleoside triphosphate diphosphohydrolase 3
18	9606.ENSP00000360561	0.908	Ectonucleoside triphosphate diphosphohydrolase 8
19	9606.ENSP00000307674	0.906	Soluble calcium-activated nucleotidase 1
20	9606.ENSP00000365840	0.905	Ectonucleoside triphosphate diphosphohydrolase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003938	1.000	IMP dehydrogenase activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0005515	0.996	protein binding
GO:0003676	0.833	nucleic acid binding
GO:0000166	0.806	nucleotide binding
GO:0042802	0.719	identical protein binding
GO:0003677	0.405	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0032501	0.972	multicellular organismal process
GO:0006725	0.952	cellular aromatic compound metabolic process
GO:0044238	0.947	primary metabolic process
GO:1901576	0.933	organic substance biosynthetic process
GO:0019637	0.932	organophosphate metabolic process
GO:0006807	0.928	nitrogen compound metabolic process
GO:0044249	0.924	cellular biosynthetic process
GO:0055086	0.915	nucleobase-containing small molecule metabolic process
GO:1901564	0.880	organonitrogen compound metabolic process
GO:0006796	0.850	phosphate-containing compound metabolic process
GO:1901135	0.828	carbohydrate derivative metabolic process
GO:0009117	0.819	nucleotide metabolic process
GO:0090407	0.812	organophosphate biosynthetic process
GO:0044271	0.775	cellular nitrogen compound biosynthetic process
GO:0150063	0.687	visual system development
GO:0034654	0.643	nucleobase-containing compound biosynthetic process
GO:0001654	0.599	eye development
GO:0072521	0.587	purine-containing compound metabolic process
GO:0006163	0.575	purine nucleotide metabolic process
GO:1901566	0.574	organonitrogen compound biosynthetic process
GO:0009259	0.556	ribonucleotide metabolic process
GO:0009165	0.530	nucleotide biosynthetic process
GO:0009150	0.528	purine ribonucleotide metabolic process
GO:1901137	0.521	carbohydrate derivative biosynthetic process
GO:0072522	0.488	purine-containing compound biosynthetic process
GO:0006164	0.469	purine nucleotide biosynthetic process
GO:0050896	0.464	response to stimulus
GO:0009260	0.406	ribonucleotide biosynthetic process
GO:0009123	0.400	nucleoside monophosphate metabolic process
GO:0009161	0.390	ribonucleoside monophosphate metabolic process
GO:0009124	0.368	nucleoside monophosphate biosynthetic process
GO:0009167	0.363	purine ribonucleoside monophosphate metabolic process
GO:0009156	0.345	ribonucleoside monophosphate biosynthetic process
GO:0046037	0.308	GMP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.685	membrane-bounded organelle
GO:0043231	0.648	intracellular membrane-bounded organelle
GO:0070013	0.425	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11708	1.000	H2O + IMP + NAD(+) = H(+) + NADH + XMP
EC:1.1.1.205	1.000	IMP dehydrogenase.

[back to server]