StarFunc result for job id P20851

User Input

>input (252 residues)
MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKT
LFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQ
CLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCV
DGEWSSALPVCKLIQEAPKPECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYSL
ELKKAELKAKLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20851	1.000	1.000	1.092E-45	252	1.000	1.000	P20851.pdb.gz	C4BPB_HUMAN C4b-binding protein beta chain OS=Homo sapiens OX=9606 GN=C4BPB PE=1 SV=1
2	AFDB:Q9BYH1	0.300	0.097	6.524E-15	1024	0.238	0.059	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
3	AFDB:P16109	0.264	0.106	1.449E-14	830	0.194	0.059	P16109.pdb.gz	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
4	AFDB:Q4V9Z5	0.233	0.085	1.449E-14	910	0.226	0.063	Q4V9Z5.pdb.gz	SE6L2_MOUSE Seizure 6-like protein 2 OS=Mus musculus OX=10090 GN=Sez6l2 PE=1 SV=1
5	AFDB:Q6P1D5	0.289	0.100	1.994E-14	963	0.234	0.061	Q6P1D5.pdb.gz	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
6	AFDB:E7EXI2	0.244	0.087	2.894E-14	898	0.234	0.066	E7EXI2.pdb.gz
7	AFDB:Q53EL9	0.230	0.074	3.580E-14	994	0.198	0.050	Q53EL9.pdb.gz	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
8	AFDB:Q09101	0.253	0.079	4.671E-14	958	0.198	0.052	Q09101.pdb.gz	HIG_DROME Locomotion-related protein Hikaru genki OS=Drosophila melanogaster OX=7227 GN=hig PE=1 SV=2
9	AFDB:P98106	0.289	0.121	4.927E-14	768	0.198	0.065	P98106.pdb.gz	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
10	AFDB:Q01102	0.289	0.120	6.095E-14	768	0.198	0.065	Q01102.pdb.gz	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
11	PDB:2xwbF	0.236	0.094	1.712E-13	714	0.230	0.081	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
12	PDB:2gsxA	0.259	0.081	8.446E-13	951	0.222	0.059	2gsxA.pdb.gz
13	PDB:1c1zA	0.274	0.219	1.599E-12	326	0.190	0.147	1c1zA.pdb.gz
14	PDB:2q7zA	0.221	0.046	1.662E-11	1931	0.194	0.025	2q7zA.pdb.gz
15	PDB:8a7eC	0.234	0.055	3.269E-10	1524	0.183	0.030	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:8a7dQ	0.219	0.206	1.507E-8	273	0.151	0.139	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
17	PDB:1haqA	0.209	0.064	2.853E-8	1213	0.135	0.028	1haqA.pdb.gz
18	PDB:7nycC	0.368	0.131	3.530E-8	809	0.135	0.042	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4e0sB	0.280	0.100	1.247E-6	898	0.127	0.036	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:3t5oA	0.271	0.102	3.426E-6	871	0.127	0.037	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20851	0.0	526	252	1.000	1.000	C4BPB_HUMAN C4b-binding protein beta chain OS=Homo sapiens OX=9606 GN=C4BPB PE=1 SV=1
2	Q96PZ7	1.21e-29	119	3564	0.278	0.020	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
3	Q923L3	1.48e-28	116	3564	0.266	0.019	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
4	Q80T79	2.64e-22	98.2	3707	0.210	0.014	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
5	D3Z9F7	4.17e-19	88.6	1406	0.258	0.046	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
6	Q4LDE5	9.30e-19	87.8	3571	0.198	0.014	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
7	A8JUT1	1.31e-18	87.0	755	0.202	0.068	A8JUT1_DROME Furrowed, isoform B OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
8	Q9VYR4	1.40e-18	87.0	1174	0.202	0.043	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
9	A2AVA0	1.82e-18	86.7	3567	0.218	0.015	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
10	P19070	3.02e-18	85.9	1025	0.242	0.060	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
11	P00751	4.14e-18	85.5	764	0.238	0.079	CFAB_HUMAN Complement factor B OS=Homo sapiens OX=9606 GN=CFB PE=1 SV=2
12	P91658	4.58e-18	85.5	974	0.198	0.051	P91658_DROME Furrowed OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
13	Q00690	4.59e-18	85.1	612	0.194	0.080	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
14	G3V615	9.16e-18	84.3	763	0.238	0.079	G3V615_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 GN=Cfb PE=4 SV=1
15	P04186	9.42e-18	84.3	761	0.234	0.078	CFAB_MOUSE Complement factor B OS=Mus musculus OX=10090 GN=Cfb PE=1 SV=2
16	Q6MG74	9.60e-18	84.3	761	0.238	0.079	Q6MG74_RAT C3/C5 convertase OS=Rattus norvegicus OX=10116 GN=Cfb PE=2 SV=1
17	Q8INW2	3.12e-17	83.2	1676	0.238	0.036	Q8INW2_DROME Hig-anchoring scaffold protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Hasp PE=1 SV=1
18	B7YZX0	3.27e-17	83.2	1677	0.238	0.036	B7YZX0_DROME Hig-anchoring scaffold protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Hasp PE=1 SV=2
19	Q9VIU9	3.37e-17	82.8	1356	0.238	0.044	Q9VIU9_DROME Hig-anchoring scaffold protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Hasp PE=1 SV=3
20	A0A1D5NSM8	5.78e-17	82.4	3615	0.198	0.014	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00084 Sushi	6.7e-23	92.2	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243611

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415941	0.943	Complement C4-B
2	9606.ENSP00000396688	0.925	Complement C4-A
3	9606.ENSP00000377783	0.918	Vitamin K-dependent protein S
4	9606.ENSP00000356037	0.871	C4b-binding protein alpha chain
5	9606.ENSP00000378130	0.768	Complement factor I
6	9606.ENSP00000327786	0.680	Izumo sperm-egg fusion protein 1
7	9606.ENSP00000460971	0.662	Zona pellucida sperm-binding protein 2
8	9606.ENSP00000332963	0.651	Sperm-egg fusion protein Juno
9	9606.ENSP00000299367	0.625	Complement C2
10	9606.ENSP00000378326	0.591	Zona pellucida sperm-binding protein 3
11	9606.ENSP00000224181	0.590	Complement component C8 gamma chain
12	9606.ENSP00000414906	0.590	Dynactin subunit 4
13	9606.ENSP00000354458	0.581	Complement component C8 alpha chain
14	9606.ENSP00000309233	0.574	POM121 and ZP3 fusion
15	9606.ENSP00000181383	0.567	Carboxypeptidase B2
16	9606.ENSP00000356771	0.564	Coagulation factor V
17	9606.ENSP00000356391	0.547	Complement factor H-related protein 2
18	9606.ENSP00000360281	0.546	Complement component C8 beta chain
19	9606.ENSP00000356385	0.538	Complement factor H-related 2
20	9606.ENSP00000356386	0.537	Complement factor H-related protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050776	0.989	regulation of immune response
GO:0048518	0.982	positive regulation of biological process
GO:0002697	0.973	regulation of immune effector process
GO:0006950	0.960	response to stress
GO:0032501	0.941	multicellular organismal process
GO:0002920	0.923	regulation of humoral immune response
GO:0030449	0.908	regulation of complement activation
GO:0050817	0.882	coagulation
GO:0050878	0.879	regulation of body fluid levels
GO:0002683	0.870	negative regulation of immune system process
GO:0044419	0.851	biological process involved in interspecies interaction between organisms
GO:0007599	0.849	hemostasis
GO:0051707	0.841	response to other organism
GO:0050794	0.825	regulation of cellular process
GO:0050777	0.824	negative regulation of immune response
GO:0042060	0.813	wound healing
GO:0002698	0.802	negative regulation of immune effector process
GO:0002820	0.747	negative regulation of adaptive immune response
GO:0002712	0.746	regulation of B cell mediated immunity
GO:0002921	0.710	negative regulation of humoral immune response
GO:0019222	0.650	regulation of metabolic process
GO:0002707	0.636	negative regulation of lymphocyte mediated immunity
GO:0002889	0.636	regulation of immunoglobulin mediated immune response
GO:0002823	0.636	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0007596	0.617	blood coagulation
GO:0009608	0.614	response to symbiont
GO:0060255	0.585	regulation of macromolecule metabolic process
GO:0080090	0.559	regulation of primary metabolic process
GO:0009894	0.523	regulation of catabolic process
GO:0009893	0.480	positive regulation of metabolic process
GO:0009896	0.403	positive regulation of catabolic process
GO:0051171	0.401	regulation of nitrogen compound metabolic process
GO:0051246	0.385	regulation of protein metabolic process
GO:0006959	0.376	humoral immune response
GO:0042176	0.376	regulation of protein catabolic process
GO:0010604	0.373	positive regulation of macromolecule metabolic process
GO:0048584	0.350	positive regulation of response to stimulus
GO:0002252	0.346	immune effector process
GO:0051247	0.341	positive regulation of protein metabolic process
GO:0050778	0.332	positive regulation of immune response
GO:0009987	0.331	cellular process
GO:0006956	0.324	complement activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005615	0.998	extracellular space
GO:0005886	0.991	plasma membrane
GO:0031982	0.853	vesicle
GO:0005622	0.345	intracellular anatomical structure
GO:0005737	0.314	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]