StarFunc result for job id P20908

User Input

>input (1838 residues)
MDVHTRWKARSALRPGAPLLPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTG
FCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
NEQGIQQIGLELGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRIALSVHKKNVTLI
LDCKKKTTKFLDRSDHPMIDINGIIVFGTRILDEEVFEGDIQQLLFVSDHRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYYTEGDGEGETYYYEYPYYEDPEDLGKEPTPSKKPVEAA
KETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEG
EENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPY
YDPTSSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLP
GPPGTMGPTGQVGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPMVS
AQESQAQAILQQARLALRGPAGPMGLTGRPGPVGPPGSGGLKGEPGDVGPQGPRGVQGPP
GPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGPPGDD
GERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPGPP
GQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPP
GPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGED
GPEGPKGRGGPNGDPGPLGPPGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGR
GTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTGFP
GPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPP
GPPGEQGLPGLAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGNEGPP
GPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGLQGPV
GLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEP
GPRGQQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPS
GAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGERGEKGESGPSGAA
GPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPT
GEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLR
GIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEK
GDRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHP
GPPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGNGENYVDYADGMEEIFGSLNSLKL
EIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTC
VFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQ
NVTYHCYQSVAWQDAATGSYDKALRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKTVL
EIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F6T0B3	0.226	0.248	0.000	1650	0.640	0.713	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
2	AFDB:I3ISS1	0.317	0.323	0.000	1803	0.685	0.698	I3ISS1.pdb.gz
3	AFDB:P12107	0.296	0.300	0.000	1806	0.732	0.745	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
4	AFDB:Q9JI03	0.175	0.175	0.000	1840	0.949	0.948	Q9JI03.pdb.gz	CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus OX=10116 GN=Col5a1 PE=1 SV=1
5	AFDB:P25940	0.273	0.286	2.162E-100	1745	0.564	0.594	P25940.pdb.gz	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
6	AFDB:Q9JLI2	0.235	0.246	3.366E-100	1739	0.562	0.594	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
7	AFDB:Q8IZC6	0.106	0.105	5.254E-46	1860	0.366	0.361	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
8	AFDB:Q17RW2	0.124	0.131	2.819E-44	1714	0.349	0.375	Q17RW2.pdb.gz	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
9	AFDB:A0MSJ1	0.123	0.134	4.637E-44	1658	0.350	0.388	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
10	AFDB:Q5QNQ9	0.113	0.113	6.972E-43	1845	0.360	0.358	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
11	PDB:7zl1A	0.078	0.580	2.825E-6	215	0.017	0.149	7zl1A.pdb.gz
12	PDB:3v0aB	0.077	0.118	4.647E-6	1150	0.014	0.023	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:3o12A	0.055	0.341	1.485E-5	185	0.014	0.135	3o12A.pdb.gz
14	PDB:4pbpB	0.068	0.506	4.247E-5	210	0.015	0.129	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
15	PDB:7qfqA	0.069	0.096	5.600E-5	1291	0.014	0.020	7qfqA.pdb.gz
16	PDB:7ufgB	0.078	0.116	5.919E-5	1182	0.016	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7ufgA	0.077	0.118	1.088E-4	1151	0.015	0.023	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:6l6aA	0.058	0.501	1.149E-4	142	0.009	0.120	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
19	PDB:8a7eC	0.077	0.091	1.516E-4	1524	0.016	0.019	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:5n0cA	0.077	0.107	1.789E-4	1293	0.014	0.019	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K069	1422	1736	0.651	0.690	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
2	A0A8I5ZM36	1201	1715	0.581	0.623	A0A8I5ZM36_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
3	A0A8I5ZR92	1188	1676	0.572	0.627	A0A8I5ZR92_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
4	A0A8I5ZY93	1429	1710	0.651	0.699	A0A8I5ZY93_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
5	A0A8I6A1U6	1188	1655	0.572	0.636	A0A8I6A1U6_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
6	A0A8I6AUU9	1199	1689	0.576	0.627	A0A8I6AUU9_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
7	F1R5X4	1468	1721	0.664	0.709	F1R5X4_DANRE Collagen alpha-2(XI) chain isoform X6 OS=Danio rerio OX=7955 GN=col11a1 PE=1 SV=2
8	F6T0B3	1186	1629	0.577	0.651	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
9	F7EVZ0	1046	1736	0.496	0.525	F7EVZ0_RAT Collagen type V alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col5a3 PE=4 SV=1
10	O88207	2163	1838	0.940	0.940	CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus OX=10090 GN=Col5a1 PE=1 SV=2
11	P12107	1700	1806	0.745	0.758	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
12	P13942	1392	1736	0.652	0.690	COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens OX=9606 GN=COL11A2 PE=1 SV=5
13	P20908	3403	1838	1.000	1.000	CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens OX=9606 GN=COL5A1 PE=1 SV=3
14	P20909	1712	1804	0.733	0.747	COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus OX=10116 GN=Col11a1 PE=1 SV=2
15	P25940	1105	1745	0.550	0.579	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
16	Q28083	645	911	0.370	0.746	COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus OX=9913 GN=COL11A1 PE=1 SV=1
17	Q32S24	1423	1736	0.652	0.691	COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus OX=9913 GN=COL11A2 PE=3 SV=1
18	Q61245	1750	1804	0.732	0.746	COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus OX=10090 GN=Col11a1 PE=1 SV=2
19	Q64739	1460	1736	0.653	0.692	COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus OX=10090 GN=Col11a2 PE=2 SV=3
20	Q6MGB2	1134	1617	0.554	0.630	Q6MGB2_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	1.6e-94	327.2	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	5.2e-160	530.7	Collagen triple helix repeat (20 copies)
3	PF00054 Laminin_G_1	1.4e+02	14.1	Laminin G domain
4	PF02210 Laminin_G_2	0.76	21.8	Laminin G domain
5	PF13385 Laminin_G_3	2.3e+02	13.3	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360882

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223061	0.981	Procollagen C-endopeptidase enhancer 1
2	9606.ENSP00000364000	0.979	Collagen alpha-2(V) chain
3	9606.ENSP00000251582	0.972	A disintegrin and metalloproteinase with thrombospondin motifs 2
4	9606.ENSP00000305714	0.970	Bone morphogenetic protein 1
5	9606.ENSP00000297268	0.963	Collagen alpha-2(I) chain
6	9606.ENSP00000225964	0.955	Collagen alpha-1(I) chain
7	9606.ENSP00000379350	0.943	Integrin beta-1
8	9606.ENSP00000452786	0.942	Integrin beta-3
9	9606.ENSP00000300527	0.940	Collagen alpha-2(VI) chain
10	9606.ENSP00000362304	0.939	A disintegrin and metalloproteinase with thrombospondin motifs 14
11	9606.ENSP00000384999	0.936	Prolyl 4-hydroxylase subunit alpha-2
12	9606.ENSP00000261023	0.935	Integrin alpha-V
13	9606.ENSP00000295992	0.935	Procollagen C-endopeptidase enhancer 2
14	9606.ENSP00000263556	0.933	Prolyl 4-hydroxylase subunit alpha-1
15	9606.ENSP00000282588	0.930	Integrin alpha-1
16	9606.ENSP00000286657	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 3
17	9606.ENSP00000401749	0.924	Prolyl 4-hydroxylase subunit alpha-3
18	9606.ENSP00000266718	0.923	Lumican
19	9606.ENSP00000370542	0.916	Syndecan-1
20	9606.ENSP00000304408	0.914	Collagen alpha-1(III) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008201	1.000	heparin binding
GO:0005201	0.999	extracellular matrix structural constituent
GO:0030020	0.959	extracellular matrix structural constituent conferring tensile strength
GO:0043394	0.787	proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0048856	0.987	anatomical structure development
GO:0032501	0.980	multicellular organismal process
GO:0048513	0.932	animal organ development
GO:0030199	0.930	collagen fibril organization
GO:0009653	0.856	anatomical structure morphogenesis
GO:0065007	0.837	biological regulation
GO:0009888	0.804	tissue development
GO:0050789	0.784	regulation of biological process
GO:0007275	0.766	multicellular organism development
GO:0050794	0.662	regulation of cellular process
GO:0048731	0.550	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005576	0.998	extracellular region
GO:0099080	0.986	supramolecular complex
GO:0070013	0.986	intracellular organelle lumen
GO:0012505	0.985	endomembrane system
GO:0098644	0.979	complex of collagen trimers
GO:0099512	0.976	supramolecular fiber
GO:0005583	0.972	fibrillar collagen trimer
GO:0043227	0.964	membrane-bounded organelle
GO:0005737	0.953	cytoplasm
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005615	0.905	extracellular space
GO:0005788	0.862	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]